ESTScan Details for Unigene SGN-U248837

Score 
650
Direction 
Forward
Predicted Peptide Sequence 
DSESSDSDSSADPDISQTVPSAESMDENTAEVNSKEDSSPSKAEVQSRPCNAEDFATWQRIIRLDAVRANAEWIAYSPSQAVVSESRAHR
FAEAVGLKDYEHLEPPRILHAARLVSILEAYALYDPEIGYCQGMSDLLSPIISVMTEDHEAFWCFVGFMTKARHNFRLDEVGIRRQLNII
SKIIKQKDSHLYRHLEKLQAEDCFFVYRMVVVLFRRELSFEQTLCLWEVMWADQAAIRAGIGKSPWSRIRLRAPPTDDLLLYAIAASVLQ
RRKQIIEKYSSMDEILRECQSMAGQLDVWKLLDDAHXLGRYSPRQDVDIFVMVLSRFYTNXILFAARTLFCGMVLPNTACISGTQEQLLY
LKTAYGQXTAAAFLLLKKHANVKKKLHLGNNLCDLSPTYRLANCLNSXVAIRWKPDWCTMLDIEFFNLVXLVNAXPKVAFYLEYLSPVAP
TSPRQMGFLLNVLFENGDGIVDDRIAYHPRTVVGL
Predicted Coding Sequence 
XCTGATTCCGAGTCATCAGACTCAGATTCCTCTGCAGATCCTGATATCAGTCAAACTGTCCCCTCGGCAGAAAGCATGGATGAGAATACT
GCTGAAGTGAACTCTAAGGAGGACTCTTCTCCTTCAAAGGCAGAAGTCCAGTCACGGCCCTGCAATGCAGAAGATTTTGCTACATGGCAA
CGAATAATTCGGCTTGATGCGGTTCGTGCTAACGCCGAATGGATAGCATACTCCCCATCTCAAGCTGTAGTATCAGAAAGCAGGGCACAC
CGTTTTGCAGAGGCTGTTGGGTTGAAGGACTATGAACACCTAGAGCCCCCTAGGATCCTACATGCTGCTCGGCTAGTCTCCATTCTTGAA
GCCTATGCGCTATATGACCCTGAAATTGGTTATTGCCAGGGGATGAGCGATTTGCTGTCACCCATAATTTCTGTAATGACAGAGGACCAT
GAAGCTTTTTGGTGCTTTGTTGGTTTCATGACGAAGGCTCGGCATAACTTCAGGCTTGATGAGGTTGGAATCAGGAGGCAGCTGAACATT
ATTTCTAAGATCATCAAACAAAAGGATTCACATCTGTATCGACACTTGGAGAAGCTCCAAGCAGAGGATTGCTTTTTTGTGTACAGAATG
GTGGTAGTTCTTTTCAGGCGGGAATTATCTTTTGAGCAAACGCTCTGCCTATGGGAAGTAATGTGGGCAGACCAGGCTGCTATTAGGGCT
GGGATTGGCAAGTCTCCCTGGAGTAGGATTAGGCTGCGTGCCCCACCAACAGATGATCTCTTGCTTTATGCAATTGCAGCATCTGTATTG
CAACGGAGGAAACAGATCATAGAGAAGTATAGTAGCATGGATGAAATTTTAAGGGAGTGTCAGAGCATGGCTGGTCAACTGGATGTATGG
AAGCTTCTAGATGATGCCCATGXACTTGGTCGTTACTCTCCACGACAAGATGTAGACATCTTTGTTATGGTGCTATCCAGGTTTTACACT
AATXTTATTCTCTTTGCTGCTCGAACGTTATTTTGTGGGATGGTGCTACCAAACACTGCATGCATCTCTGGTACACAGGAACAACTGCTC
TACCTGAAGACAGCTTATGGTCAAGXTACTGCCGCTGCTTTTCTTTTGCTAAAGAAACATGCAAATGTCAAAAAGAAGCTGCACTTGGGA
AATAACTTATGTGACTTATCTCCTACATACAGACTTGCAAATTGCTTGAATTCAGXTGTAGCAATTCGCTGGAAGCCTGATTGGTGTACC
ATGCTTGATATTGAATTTTTTAACTTAGTTXCTCTTGTTAATGCTXCTCCTAAGGTGGCTTTTTATTTGGAGTATTTATCTCCTGTTGCC
CCAACCTCCCCAAGGCAAATGGGGTTTCTTTTGAATGTTCTCTTTGAAAATGGAGATGGGATTGTGGATGATAGAATAGCATACCATCCA
CGCACTGTGGTTGGTTTGTAA\
Edits in Original Sequence 
(5')XCTGATTCCGAGTCATCAGACTCAGATTCCTCTGCAGATCCTGATATCAGTCAAACTGTCCCCTCGGCAGAAAGCATGGATGAGAA
TACTGCTGAAGTGAACTCTAAGGAGGACTCTTCTCCTTCAAAGGCAGAAGTCCAGTCACGGCCCTGCAATGCAGAAGATTTTGCTACATG
GCAACGAATAATTCGGCTTGATGCGGTTCGTGCTAACGCCGAATGGATAGCATACTCCCCATCTCAAGCTGTAGTATCAGAAAGCAGGGC
ACACCGTTTTGCAGAGGCTGTTGGGTTGAAGGACTATGAACACCTAGAGCCCCCTAGGATCCTACATGCTGCTCGGCTAGTCTCCATTCT
TGAAGCCTATGCGCTATATGACCCTGAAATTGGTTATTGCCAGGGGATGAGCGATTTGCTGTCACCCATAATTTCTGTAATGACAGAGGA
CCATGAAGCTTTTTGGTGCTTTGTTGGTTTCATGACGAAGGCTCGGCATAACTTCAGGCTTGATGAGGTTGGAATCAGGAGGCAGCTGAA
CATTATTTCTAAGATCATCAAACAAAAGGATTCACATCTGTATCGACACTTGGAGAAGCTCCAAGCAGAGGATTGCTTTTTTGTGTACAG
AATGGTGGTAGTTCTTTTCAGGCGGGAATTATCTTTTGAGCAAACGCTCTGCCTATGGGAAGTAATGTGGGCAGACCAGGCTGCTATTAG
GGCTGGGATTGGCAAGTCTCCCTGGAGTAGGATTAGGCTGCGTGCCCCACCAACAGATGATCTCTTGCTTTATGCAATTGCAGCATCTGT
ATTGCAACGGAGGAAACAGATCATAGAGAAGTATAGTAGCATGGATGAAATTTTAAGGGAGTGTCAGAGCATGGCTGGTCAACTGGATGT
ATGGAAGCTTCTAGATGATGCCCATGXACTTGGTCGTTACTCTCCACGACAAGATGTAGACATCTTTGTTATGGTGCTATCCAGGTTTTA
CACTAATXTTATTCTCTTTGCTGCTCGAACGTTATTTTGTGGGATGGTGCTACCAAACACTGCATGCATCTCTGGTACACAGGAACAACT
GCTCTACCTGAAGACAGCTTATGGTCAAGXTACTGCCGCTGCTTTTCTTTTGCTAAAGAAACATGCAAATGTCAAAAAGAAGCTGCACTT
GGGAAATAACTTATGTGACTTATCTCCTACATACAGACTTGCAAATTGCTTGAATTCAGXTGTAGCAATTCGCTGGAAGCCTGATTGGTG
TACCATGCTTGATATTGAATTTTTTAACTTAGTTXCTCTTGTTAATGCTXCTCCTAAGGTGGCTTTTTATTTGGAGTATTTATCTCCTGT
TGCCCCAACCTCCCCAAGGCAAATGGGGTTTCTTTTaGAATGTTCTCTTTGAAAATGGAGATGGGATTGTGGATGATAGAATAGCATACC
tATCCACGCACTGTGGTTGGTTTGTAA\(3')CTTTATCATCAAAGCAATAGCTATACGGAAGGAACCCTTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan