ESTScan Details for Unigene SGN-U248880

Score 
424
Direction 
Forward
Predicted Peptide Sequence 
MGGAQAMKRIPRIKFPQRHSKHSGTTSQNSQHQKTPAAEETPRTFFSRSPPSMSVAGKASDQPKRTPVTQEEIESILLGAASNFKANYLQ
RDDTAHNCTLMFSDWLTTFSVYVLAVVLLETSDMIVNNSLCTEWLSRPGLANYCVH
Predicted Coding Sequence 
XCAATGGGTGGAGCGCAGGCAATGAAGAGAATTCCACGAATCAAGTTTCCACAGAGGCATTCAAAGCATTCTGGTACCACATCACAGAAT
TCCCAACATCAGAAAACTCCAGCAGCTGAAGAAACTCCTCGAACATTTTTCTCAAGGTCCCCACCTAGCATGTCTGTTGCAGGGAAGGCT
TCTGATCAACCCAAAAGAACACCAGTTACTCAGGAGGAAATTGAATCCATTCTGTTGGGTGCTGCATCTAACTTCAAAGCAAATTACCTT
CAGAGAGATGACACAGCTCACAACTGCACGCTCATGTTTAGTGACTGGTTGACTACATTTTCTGTTTATGTTTTAGCTGTTGTACTTCTT
GAAACCAGTGACATGATTGTTAATAATTCATTATGCACGGAATGGTTATCGAGACCTGGATTGGCAAACTACTGTGTACATTGA\
Edits in Original Sequence 
(5')XCAATGGGTGGAGCGCAGGCAATGAAGAGAATTCCACGAATCAAGTTTCCACAGAGGCATTCAAAGCATTCTGGTACCACATCACA
GAATTCCCAACATCAGAAAACTCCAGCAGCTGAAGAAACTCCTCGAACATTTTTCTCAAGGTCCCCACCTAGCATGTCTGTTGCAGGGAA
GGCTTCTGATCAACCCAAAAGAACACCAGTTACTCAGGAGGAAATTGAATCCATTCTGTTGGGTgGCTGCATCTAACTTCAAAGCAAATT
ACCTTCAGAGAGATGACACAGCTCACAACTGCACGCTCATGTTTAGTGACTGGTTGACTACATTTTCgTGTTTATGTTTTAGCTGTTGTA
CTTCTTGAAACCAGTGACATGATTGTTAATAATTCATTATGCACGGAATGGTTATCGAGACCTGGATTGGCAAACTACTGTGTACATTGA
\(3')TAGGCCTTTTTTTTTTTATGCAGAATGTAACCATTTGCAGAANANNNANAAANAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan