ESTScan Details for Unigene SGN-U248962

Score 
422
Direction 
Forward
Predicted Peptide Sequence 
GFLSASLDKDREACANQLVGLATCLPYVSGEAKAPTPDCCTGLKEVLDKSKICLCILVKDRNDPSLGLKINATLALSLPTLCHAPPNMSN
VSMCTDLLHLAPNSPDAKVFQDFAKGSSAAPSAPVSGNSSGKPANSSTNDKNDGGHXKEMDGIYGNDYGLFGHFGAFISHLTLKNIIIVX
Predicted Coding Sequence 
GGGTTTTTGAGCGCGAGTCTCGATAAAGATAGAGAAGCATGTGCTAACCAACTCGTCGGTTTGGCCACGTGTCTTCCTTATGTCAGCGGT
GAAGCCAAAGCTCCCACACCGGATTGTTGCACCGGTTTAAAAGAAGTTTTAGACAAGAGCAAAATATGCCTATGTATCTTGGTAAAAGAC
AGAAATGACCCTAGCCTTGGTCTTAAGATCAATGCTACACTTGCATTAAGCCTCCCTACTTTATGTCATGCTCCCCCTAATATGTCTAAT
GTATCTATGTGCACCGATTTGTTGCATTTGGCACCAAATTCACCAGATGCTAAGGTTTTTCAAGATTTTGCAAAAGGAAGTTCTGCTGCT
CCATCTGCACCAGTTAGTGGGAACTCTAGTGGAAAACCAGCAAATTCTTCAACAAATGATAAGAATGATGGAGGACATAAXAAGGAGATG
GATGGGATTTATGGAAATGACTATGGGCTTTTTGGTCATTTTGGTGCTTTCATATCTCACCTAACTTTGAAAAACATAATTATTGTTTTX
\
Edits in Original Sequence 
TACCACACCTATTTTTCTCCATTCATTTAGAACACATCACAATAAATACAATTATTGTCACAAAAACAAAGCATAAAAAGAAAACTTTCC
CATCACCTATTCATTATTTTGTCTATACATCTTTCTTTCATACTCCCAAATTATCCTTCAAAAAAAAAAAAACACAAATTGTTCCAAATG
AGTTCAAAAAAACTTGTGACTTTTGAACTTTCTTTCTTCTTCTTGATCTTATTATTA
(5')GGGTTTTTGAGCGCGAGTCTCGATAAAGA
TAGAGAAGCATGTGCTAACCAACTCGTCGGTTTGGCCACGTGTCTTCCTTATGTCAGCGGTGAAGCCAAAGCTCCCACACCGGATTGTTG
CACCGGTTTAAAAGAAGTTTTAGACAAGAGCAAAATATGCCTATGTATCTTGGTAAAAGACAGAAATGACCCTAGCCTTGGTCTTAAGAT
CAATGCTACACTTGCATTAAGCCTCCCTACTTTATGTCATGCTCCCCCTAATATGTCTAATGTATCTATGTGCACCGATTTGTTGCATTT
GGCACCAAATTCACCAGATGCTAAGGTTTTTCAAGATTTTGCAAAAGGAAGTTCTGCTGCTCCATCTGCACCAGTTAGTGGGAACTCTAG
TGGAAAACCAGCAAATTCTTCAACAAATGATAAGAATGATGGAGGACATAAXAAGGAGATGGATGGGATTTATGGAAATGACTATGGGCT
TTTTGGTCATTTTGGTGCTTTCATATCTCACCTAACTTTGAAAAACATAATTATTGTTTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan