ESTScan Details for Unigene SGN-U248967

Score 
481
Direction 
Forward
Predicted Peptide Sequence 
MEETNMDDCEHNRESEVAPALIAVHPTQKSVAVAVGSNLRVFNLQEGCSVSLVDDSGVHMHRDSIRAIRYGAEGKLFVSAGDDKLVKIWV
TDSWRCISSVSSEKRVTAVAISNDGRFVSFADKFGVIYAVEIEGSHENQSLPNKKAVPILAHYCSIITSLEFSPDGRYIISADRDFKIRV
SVFPEKPSDGAHEIQSFCLGHSEFVSCLALHLQPGFPAVVFALGGGDSTVRLWDFTCGSLLDTCHVGETGLLQSKERIDDRLLAVTDLCA
TPGGSLIA
Predicted Coding Sequence 
ATGGAGGAAACTAACATGGATGATTGTGAACACAACCGTGAATCTGAGGTTGCTCCGGCGTTAATTGCAGTTCACCCAACTCAGAAATCA
GTCGCCGTTGCCGTCGGTTCGAATCTCCGCGTCTTTAACCTTCAAGAAGGTTGTTCGGTTTCATTGGTGGATGATTCAGGAGTGCACATG
CATAGGGATTCAATAAGAGCAATTCGATATGGTGCTGAAGGAAAGCTGTTTGTATCTGCTGGCGATGACAAACTTGTTAAGATTTGGGTT
ACTGATTCTTGGCGGTGCATAAGTTCGGTGTCATCCGAGAAGAGAGTTACTGCTGTTGCCATCAGTAATGATGGGCGTTTTGTATCCTTC
GCGGATAAATTTGGTGTAATTTATGCAGTTGAAATAGAAGGTTCTCATGAAAATCAAAGTCTGCCCAATAAGAAGGCAGTCCCAATTCTC
GCCCACTACTGCAGCATCATTACTAGTCTGGAGTTTTCACCTGATGGACGATACATTATTAGTGCCGATCGGGACTTCAAAATCCGAGTC
TCTGTGTTCCCGGAAAAGCCGTCAGATGGGGCTCATGAGATTCAAAGTTTTTGCCTTGGCCATTCAGAGTTTGTTTCCTGCCTTGCXCTT
CATCTGCAGCCAGGATTCCCAGCAGTGGTATTTGCTTTGGGAGGTGGTGATTCAACTGTACGCTTGTGGGACTTCACTTGTGGTTCTCTT
CTCGATACCTGTCATGTTGGAGAGACAGGACTATTACAGTCAAAAGAAAGAATAGATGACAGGTTGCTGGCTGTCACTGATCTCTGTGCC
ACTCCTGGTGGATCACTAATCGCX\
Edits in Original Sequence 
GAGAGAGAAAGAGGAAGGTTTTACTCTACTGAACAACA(5')ATGGAGGAAACTAACATGGATGATTGTGAACACAACCGTGAATCTGAG
GTTGCTCCGGCGTTAATTGCAGTTCACCCAACTCAGAAATCAGTCGCCGTTGCCGTCGGTTCGAATCTCCGCGTCTTTAACCTTCAAGAA
GGTTGTTCGGTTTCATTGGTGGATGATTCAGGAGTGCACATGCATAGGGATTCAATAAGAGCAATTCGATATGGTGCTGAAGGAAAGCTG
TTTGTATCTGCTGGCGATGACAAACTTGTTAAGATTTGGGTTACTGATTCTTGGCGGTGCATAAGTTCGGTGTCATCCGAGAAGAGAGTT
ACTGCTGTTGCCATCAGTAATGATGGGCGTTTTGTATCCTTCGCGGATAAATTTGGTGTAATTTATGCAGTTGAAATAGAAGGTTCTCAT
GAAAATCAAAGTCTGCCCAATAAGAAGGCAGTCCCAATTCTCGCCCACTACTGCAGCATCATTACTAGTCTGGAGTTTTCACCTGATGGA
CGATACATTATTAGTGCCGATCGGGACTTCAAAATCCGAGTCTCTGTGTTCCCGGAAAAGCCGTCAGATGGGGCTCATGAGATTCAAAGT
TTTTGCCTTGGCCATTCAGAGTTTGTTTCCTGCCTTGCXCTTCATCTGCAGCCAGGATTCCCAGCAGTGGTATTTGCTTTcGGGAGGTGG
TGATTCAACTGTACGCTTGTGGGACTTCACTTGTGGTTCTCTTCTCGATACCTGTCATGTTGGAGAGACAGGACTATTACAGTCAAAAGA
AAGAATAGATGACAGGTTGCTGGCTGTCACTGATCTCTGTGCCACTCCTGGTGGATCACTAATCGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan