ESTScan Details for Unigene SGN-U249318

Score 
670
Direction 
Forward
Predicted Peptide Sequence 
DDYCFESSDLWSVIFPSDSEKIIATSTRKLSEVVHTQAKVNADQDVLYKYISKNLLFLATVTPKAMGDIGSVTPEDSWLFVYLVDTITGR
VLLRMSHHGCQGPVHAVFSENWVVYHYFNLRAHRYEMSVVEIYDQSRADNKDVLKLVLGKHNLSAPVSSYSRPEIMTKSQSYFFTHSVKA
VAVTSTAKGITSKQLLIGTIGDQVLALDKRFLDPRRTLNPTQAEKEEGIMPLTDTLPIMPQAFVTHALKVEGLRSIIAIPAKLESTTLIF
AHGVDLFFTRLAPSKTYDSLTDDFNYALLLLTIVALVISIFVTGFGLRGKIYRRSGGEPFNQQSGGESKAITLPSIVVLF
Predicted Coding Sequence 
XCTGATGACTACTGTTTTGAATCCAGTGACCTTTGGTCTGTTATATTCCCCTCAGATTCAGAAAAGATCATTGCAACTTCAACCAGAAAA
TTAAGTGAGGTTGTTCATACGCAAGCTAAAGTTAACGCTGACCAGGATGTATTGTATAAATATATATCTAAGAATTTGTTGTTTCTGGCC
ACTGTTACTCCTAAAGCAATGGGTGACATTGGATCAGTGACCCCTGAAGATTCCTGGCTTTTTGTTTATCTTGTTGACACAATAACTGGC
CGAGTGCTGCTCCGTATGTCTCATCATGGCTGTCAGGGACCTGTACATGCAGTATTTAGCGAAAATTGGGTTGTCTATCACTACTTCAAC
CTGCGTGCACACAGATATGAGATGTCTGTCGTTGAGATCTACGACCAGTCTCGCGCGGACAACAAAGATGTCTTGAAGCTTGTTCTTGGA
AAGCATAATCTTAGTGCGCCTGTCTCTTCCTACTCGCGTCCTGAAATCATGACCAAGTCTCAATCTTACTTTTTCACACATAGTGTGAAA
GCAGTAGCAGTTACCTCAACAGCAAAAGGCATCACTTCCAAACAACTGCTTATTGGCACAATTGGTGATCAGGTTTTGGCACTTGACAAG
CGTTTTCTTGATCCTCGTCGAACACTGAACCCTACTCAAGCTGAAAAGGAGGAAGGGATTATGCCTCTTACTGATACATTGCCAATCATG
CCACAGGCTTTCGTTACACACGCCCTTAAAGTGGAAGGCCTTAGAAGCATAATAGCTATACCGGCAAAGCTAGAGTCAACCACCCTCATC
TTTGCTCACGGAGTTGATCTCTTTTTCACTCGGCTTGCTCCTTCAAAGACATATGACTCTCTCACCGATGATTTCAATTATGCTTTGCTT
CTCCTTACCATAGTTGCCCTAGTTATATCAATTTTCGTAACTGGATTTGGTCTGAGAGGAAAGATTTACAGGAGAAGTGGAGGTGAGCCT
TTCAATCAACAAAGTGGAGGCGAGTCCAAAGCCATTACACTTCCTTCAATCGTTGTATTGTTTTAG\
Edits in Original Sequence 
(5')XCTGATGACTACTGTTTTGAATCCAGTGACCTTTGGTCTGTTATATTCCCCTCAGATTCAGAAAAGATCATTGCAACTTCAACCAG
AAAATTAAGTGAGGTTGTTCATACGCAAGCTAAAGTTAACGCTGACCAGGATGTATTGTATAAATATATATCTAAGAATTTGTTGTTTCT
GGCCACTGTTACTCCTAAAGCAATGGGTGACATTGGATCAGTGACCCCTGAAGATTCCTGGCTTTTTGTTTATCTTGTTGACACAATAAC
TGGCCGAGTGCTGCTCCGTATGTCTCATCATGGCTGTCAGGGACCTGTACATGCAGTATTTAGCGAAAATTGGGTTGTCTATCACTACTT
CAACCTGCGTGCACACAGATATGAGATGTCTGTCGTTGAGATCTACGACCAGTCTCGCGCGGACAACAAAGATGTCTTGAAGCTTGTTCT
TGGAAAGCATAATCTTAGTGCGCCTGTCTCTTCCTACTCGCGTCCTGAAATCATGACCAAGTCTCAATCTTACTTTTTCACACATAGTGT
GAAAGCAGTAGCAGTTACCTCAACAGCAAAAGGCATCACTTCCAAACAACTGCTTATTGGCACAATTGGTGATCAGGTTTTGGCACTTGA
CAAGCGTTTTCTTGATCCTCGTCGAACACTGAACCCTACTCAAGCTGAAAAGGAGGAAGGGATTATGCCTCTTACTGATACATTGCCAAT
CATGCCACAGGCTTTCGTTACACACGCCCTTAAAGTGGAAGGCCTTAGAAGCATAATAGCTATACCGGCAAAGCTAGAGTCAACCACCCT
CATCTTTGCTCACGGAGTTGATCTCTTTTTCACTCGGCTTGCTCCTTCAAAGACATATGACTCTCTCACCGATGATTTCAATTATGCTTT
GCTTCTCCTTACCATAGTTGCCCTAGTTATATCAATTTTCGTAACgTGGATTTGGTCTGAGAGGAAAGATTTACAGGAGAAGTGGAGGTG
AGCCTTTCAATCAACAAAGTGGAGGCGAGTCCAAAGCCATTACACTTCCTTCAATCGTTGTATTGTTTTAG\(3')TACTCAAACCAAAT
TTTTTTTGGCACTTTAACTTAATCTTCTTAGATTAGGGAGTTAGGCTAAGTTGTACTTTTAGTAATTTTGTAAAATTGGCCCTCGTTTAG
TTTTTTCTACATGGAAGAAAATTTGTGACATTGATATTTCATTTTGGTGGCAAGAGATACAAAATTTCACACATAAGTAGCTTGACAACA
GTAATAATCTATGAACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan