ESTScan Details for Unigene SGN-U249549

Score 
253
Direction 
Forward
Predicted Peptide Sequence 
MATFELYRRSTIGMCLTETLDEMVSNGILSPEHAIQVLVQFDKSMTEALESQVKSKVTIKGHLHTYRFCDNVWTFILQDAVFKSEECQET
VNRVKIVACDSKLLTSEKTAD
Predicted Coding Sequence 
ATGGCGACTTTTGAGCTATACAGGAGGTCGACGATTGGGATGTGCTTGACTGAAACACTTGATGAAATGGTATCTAATGGAATTCTTAGC
CCGGAGCACGCCATTCAAGTTCTCGTTCAGTTTGACAAGTCAATGACTGAAGCTTTGGAGTCTCAAGTAAAGAGCAAGGTTACTATTAAG
GGACATCTTCACACCTACAGGTTCTGTGACAATGTGTGGACCTTTATCTTACAAGATGCTGTGTTCAAGAGCGAGGAATGCCAGGAGACT
GTTAACCGCGTTAAGATTGTGGCATGTGACTCAAAGCTGCTCACCAGTGAGAAGACAGCGGATTGA\
Edits in Original Sequence 
AATTGCTTTCCCTCTCTTCAACAAATTCCTCTCTCCTCTCTCTCTTTCTCTCTCGTTCTTCAATCATCTCGAAAAAAGGACTCAAAA(5')
ATGGCGACTTTTGAGCTATACAGGAGGTCGACGATTGGGATGTGCTTGACTGAAACACTTGATGAAATGGTATCTAATGGAATTCTTAG
CCCGGAGCACGCCATTCAAGTTCTCGTTCAGTTTGACAAGTCAATGACTGAAGCTTTGGAGTCTCAAGTAAAGAGCAAGGTTACTATTAA
GGGACATCTTCACACCTACAGGTTCTGTGACAATGTGTGGACCTTTATCTTACAAGATGCTGTGTTCAAGAGCGAGGAATGCCAGGAGAC
TGTTAACCGCGTTAAGATTGTGGCATGTGACTCAAAGCTGCTCAcCCAGTGAGAAGACAGCGGATTGA\(3')GAGAATTTTCTGTCTGT
TACTTATTTGCATTTCTATAATTAATGTAGAAATCGACATATTATAAGTCTGAGAGAAGAGGGTGGAGTGTAGGTGTGGTTATATCCATT
CTGGGTATATTTCCAGGACCGTTTAACACCTATATTTTGTACAAACCAGCAAACATCAATAGCTATCTGTAGTCAAACTGTTATGTTTAT
GACGCCAATGTATTTTATTATGGAACTTTTGTACAATGTTGAACTTTAGTATTTCTGACATTTATATGAGCTCAAGAATTTAAAAAAAAA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan