ESTScan Details for Unigene SGN-U249655

Score 
975
Direction 
Forward
Predicted Peptide Sequence 
MANDDDFTFCQVGAPDNQDYVDAQKIAQDISEIRIKDEPSNNDGTSQSTGAPWEGKLGNITTSKKQGTVGSLSFTVIDTSPGKQASGTSG
QVASKDGGFSVPTYQKQIKPARKPVARAKVPYEKGYSQMDWLKLTRTHPDLAGLKGQSNRRLISIDEVKEHQNAEAMWTVLKGHVYNITP
YMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEVLMEKCLVGILDEANENFVPLIPETTVSEKHSHYKKIVLNRRRYIFASSEEKLTYH
XYIGLTIYILK
Predicted Coding Sequence 
ATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGTGCACCTGATAATCAAGATTATGTGGATGCACAGAAGATTGCTCAAGATATT
AGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTACTGGTGCACCATGGGAAGGTAAATTGGGCAACATT
ACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCCAGGCAAGCAAGCAAGTGGAACTTCTGGT
CAAGTGGCATCAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGCAAATAAAACCTGCTAGGAAGCCTGTAGCTCGAGCCAAGGTC
CCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCTTGCAGGATTGAAAGGACAGTCCAACAGG
AGACTTATATCAATAGATGAGGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCTTAAAGGGCATGTCTACAATATAACACCA
TACATGAAGTTTCACCCAGGAGGTGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCACGGCATTGTTTAACAAATACCATGCTTGG
GTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGAAGCAAATGAAAACTTTGTTCCATTGATCCCAGAAACAACT
GTATCAGAGAAACATTCTCACTACAAGAAGATTGTTCTTAACAGAAGACGATACATTTTTGCTTCTTCTGAGGAAAAGCTTACATACCAT
AGXTATATTGGACTAACTATTTACATACTCAAG\
Edits in Original Sequence 
CCCCCGGGCTGCAGTTTCTCCGGCACGAGGACTGAATGCAAGGAATCAGAAGAAATTCAAGATTGTAACGTAGCGTAGGTAGTCCGACTG
CCCATCAGCTTTGAACGAACGTTGTGTCGGCTCCGACAAGCAGCGAATTGGAGGGAAAAACAGCCCTTCAAGATCAGATTCCTTGGAGAG
GACATTGCTCAGCTGAGCTAGTA
(5')ATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGTGCACCTGATAATCAAGATTATGTG
GATGCACAGAAGATTGCTCAAGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTACTGGTGCA
CCATGGGAAGGTAAATTGGGCAACATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCCA
GGCAAGCAAGCAAGTGGAACTTCTGGTCAAGTGGCATCAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGCAAATAAAACCTGCT
AGGAAGCCTGTAGCTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCTT
GCAGGATTGAAAGGACAGTCCAACAGGAGACTTATATCAATAGATGAGGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCTT
AAAGGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGTGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCACG
GCATTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGAcAGCAAATGAAAA
CTTTGTTCCATTGATCCCAGAAACAACTGTATCAGAGAAACATTCTCACTACAAGAAGATTGTTCTTAACAGAAGACGATACATTTTTGC
TTCTTCTGAGGAAAAGCTTACATACCATAGXTATATTGGACTAACTATTTACATACTCAAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan