ESTScan Details for Unigene SGN-U249893

Score 
785
Direction 
Forward
Predicted Peptide Sequence 
MWENLLGQAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSSGDAGGAADRVLNQLLTEMDGM
NAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLRKSPLSKDIDLRALAKHTQGFSGADITEICQRACKYAIRE
NIEKDIEREKRRQENPDSMDEDVDEVPEIKPAHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGTEFRFAEASSGGTAAADPFATSN
AAADDDDHIAEVXSFFLLFYCKSPTSRVKLEYRNLVLDSXLSGFDFLELKDNXKVTVYTYLYPGEYFFEFDAQVKIT
Predicted Coding Sequence 
ATGTGGGAAAACCTACTTGGCCAAGCAATTGCAAATGAATGTCAAGCCAATTTTATCAGTGTCAAAGGACCTGAACTGCTCACCATGTGG
TTTGGAGAGAGTGAGGCGAATGTTCGTGAAATTTTCGATAAAGCGAGACAATCTGCACCTTGCGTCCTCTTCTTTGATGAGCTTGACTCT
ATTGCTACTCAGAGGGGAAGCAGCAGTGGAGATGCTGGAGGAGCAGCTGATCGTGTTTTGAACCAACTTCTGACTGAAATGGATGGCATG
AATGCAAAGAAGACTGTTTTTATAATTGGGGCCACCAACAGGCCCGACATAATTGACCCTGCACTTCTTCGACCTGGCCGTCTCGACCAG
TTAATTTATATTCCTCTGCCAGATGAAGATTCACGCCATCAGATTTTCAAGGCATGTCTCAGAAAATCCCCCTTATCAAAGGATATTGAT
CTGAGAGCTCTCGCTAAACATACTCAAGGATTTAGTGGGGCTGATATCACTGAGATTTGTCAACGAGCCTGCAAATATGCCATAAGGGAG
AACATAGAGAAAGATATAGAAAGGGAGAAGAGAAGACAGGAGAATCCCGATTCGATGGATGAGGATGTTGATGAAGTACCAGAGATCAAG
CCTGCTCATTTTGAGGAGTCTATGAAGTATGCACGCCGAAGTGTCAGTGATGCTGATATACGCAAATACCAGGCATTTGCTCAGACATTA
CAGCAGTCTAGAGGTTTTGGAACAGAATTTCGATTTGCAGAGGCTAGTAGCGGCGGGACTGCTGCAGCTGACCCATTTGCAACTTCTAAT
GCTGCAGCCGATGATGATGACCATATAGCTGAAGTTXCTAGTTTTTTCTTGTTATTTTACTGCAAGTCTCCTACTTCCCGGGTTAAACTC
GAATATCGGAACCTAGTACTTGATTCTCXGCTCTCGGGTTTTGACTTTTTAGAACTTAAAGATAATXTTAAAGTTACAGTTTACACTTAC
TTATATCCTGGCGAATATTTTTTTGAATTTGATGCGCAGGTAAAAATAACCTAG\
Edits in Original Sequence 
GGCTGCAGAATCGGCACGAGGCTTTTCTATGGTCCCCCAGG(5')ATGTGGGAAAACCTACTTGGCCAAGCAATTGCAAATGAATGTCAA
GCCAATTTTATCAGTGTCAAAGGACCTGAACTGCTCACCATGTGGTTTGGAGAGAGTGAGGCGAATGTTCGTGAAATTTTCGATAAAGCG
AGACAATCTGCACCTTGCGTCCTCTTCTTTGATGAGCTTGACTCTATTGCTACTCAGAGGGGAAGCAGCAGTGGAGATGCTGGAGGAGCA
GCTGATCGTGTTTTGAACCAACTTCTGACTGAAATGGATGGCATGAATGCAAAGAAGACTGTTTTTATAATTGGGGCCACCAACAGGCCC
GACATAATTGACCCTGCACTTCTTCGACCTGGCCGTCTCGACCAGTTAATTTATATTCCTCTGCCAGATGAAGATTCACGCCATCAGATT
TTCAAGGCATGTCTCAGAAAATCCCCCTTATCAAAGGATATTGATCTGAGAGCTCTCGCTAAACATACTCAAGGATTTAGTGGGGCTGAT
ATCACTGAGATTTGTCAACGAGCCTGCAAATATGCCATAAGGGAGAACATAGAGAAAGATATAGAAAGGGAGAAGAGAAGACAGGAGAAT
CCCGATTCGATGGATGAGGATGTTGATGAAGTACCAGAGATCAAGCCTGCTCATTTTGAGGAGTCTATGAAGTATGCACGCCGAAGTGTC
AGTGATGCTGATATACGCAAATACCAGGCATTTGCTCAGACATTACAGCAGTCTAGAGGTTTTGGAACAGAATTTCGATTTGCAGAGGCT
AGTAGCGGCGGGACTGCTGCAGCTGACCCATTTGCAACTTCTAATGCTGCAGCCGATGATGATGACCtATATAGCTGAAGTTXCTAGTTT
TTTCTTGTTATTTTACTGCAAGTCTCCTACTTCCCGGGTTAAACTCGAATATCGGAACCTAGTACTTGATTCTCXGCTCTCGGGTTTTGA
CTTTTTAGAACgTTAAAGATAATXTTAAAGTTACAGTTTACACTTACTTATATCCTGGCGAATATTTTTTTGAATTTGATGCGCAGGTAA
AAATAACCTAG\(3')TTTAAACAAAAAAAGATGAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan