ESTScan Details for Unigene SGN-U249917

Score 
1002
Direction 
Forward
Predicted Peptide Sequence 
AARWIAKLATPCLLKALSIYPEYKLKIVGHSLGGGTAAILTYVLREQKELSTATCVAFAPAACMTWELAESGCEFITSVINGADLVPTFS
AASVDDLRSEVTTSAWLNDLRNQIEHTRILSTVYRSASALGSRLPSIATAKAKVAGAGAILRPVSSGTQVVMKRAQSMAQAALSRPAMQL
HHGHAWVQDVDPQLFRLILKNGKSPXGTSSGKNSETFIVESEETRSSTVMELPVSSTEGVTWNLEIDQSFADGINIHNNLDPDLDDSEHG
PEDRMTEVEMWQQLEHELYDQSEGETDVAKEIREEEAAAIAESGQTSSESSVPNTKEVHRFFPPGKIMHIVTLLCEEVDHESDSDTLSED
HNQPKDTKVGIFLTPRSLYSKIRLSQTMISDHFMPVYRRQIEKLIXDLENNDASDKSMESQVQHQ
Predicted Coding Sequence 
GCTGCTCGATGGATTGCAAAACTTGCAACGCCTTGTCTTCTTAAAGCTCTTAGCATTTATCCTGAATACAAACTTAAGATTGTGGGACAC
TCCTTGGGTGGAGGAACTGCAGCTATTTTAACTTATGTGCTTCGTGAGCAGAAGGAACTGTCAACAGCTACCTGTGTAGCATTTGCTCCA
GCTGCCTGTATGACATGGGAATTAGCTGAATCGGGGTGTGAATTTATTACCTCGGTAATCAATGGAGCTGATTTGGTCCCTACATTTTCA
GCTGCTTCAGTGGACGATTTGCGTTCTGAGGTGACAACATCTGCTTGGTTGAACGATCTAAGAAATCAGATTGAGCATACTAGGATTCTT
AGTACTGTTTATCGTTCTGCATCAGCCCTGGGGTCTCGTCTTCCATCTATCGCCACTGCTAAAGCTAAGGTTGCAGGTGCTGGTGCAATA
CTGCGGCCTGTTTCCAGTGGTACACAGGTTGTCATGAAGAGAGCGCAAAGTATGGCCCAGGCAGCATTGTCACGACCTGCCATGCAACTT
CATCATGGTCATGCATGGGTCCAAGACGTCGATCCACAGCTATTCAGGTTAATTCTGAAGAACGGCAAATCTCCTGXTGGAACTTCTTCC
GGCAAAAATTCTGAAACATTCATTGTGGAATCCGAGGAGACGAGAAGTTCGACTGTGATGGAACTTCCTGTATCTTCAACCGAGGGAGTC
ACGTGGAACTTGGAAATTGATCAATCTTTTGCAGATGGGATTAATATCCATAATAACCTGGATCCCGATCTTGATGATAGTGAACATGGA
CCTGAAGACCGAATGACAGAAGTTGAGATGTGGCAACAACTAGAGCATGAACTGTATGATCAGTCTGAAGGGGAAACTGATGTCGCGAAG
GAGATTAGGGAAGAAGAAGCAGCAGCCATTGCAGAGTCAGGTCAGACCTCAAGTGAAAGCTCTGTTCCAAACACAAAGGAGGTGCACAGA
TTCTTTCCTCCTGGAAAGATAATGCATATAGTTACTCTCCTCTGTGAGGAAGTCGATCATGAAAGTGACAGCGATACGTTGAGTGAGGAC
CATAACCAACCCAAGGATACAAAGGTTGGTATCTTTCTCACTCCTAGATCATTGTACAGTAAAATAAGGCTGTCACAAACTATGATCAGT
GATCATTTCATGCCGGTTTATAGAAGGCAGATAGAGAAACTAATTANGGATCTTGAGAACAACGATGCTAGTGACAAATCAATGGAATCT
CAGGTTCAGCATCAGTGA\
Edits in Original Sequence 
(5')GCTGCTCGATGGATTGCAAAACTTGCAACGCCTTGTCTTCTTAAAGCTCTTAGCATTTATCCTGAATACAAACTTAAGATTGTGGG
ACACTCCTTGGGTGGAGGAACTGCAGCTATTTTAACTTATGTGCTTCGTGAGCAGAAGGAACTGTCAACAGCTACCTGTGTAGCATTTGC
TCCAGCTGCCTGTATGACATGGGAATTAGCTGAATCGGGGTGTGAATTTATTACCTCGGTAATCAATGGAGCTGATTTGGTCCCTACATT
TTCAGCTGCTTCAGTGGACGATTTGCGTTCTGAGGTGACAACATCTGCTTGGTTGAACGATCTAAGAAATCAGATTGAGCATACTAGGAT
TCTTAGTACTGTTTATCGTTCTGCATCAGCCCTGGGGTCTCGTCTTCCATCTATCGCCACTGCTAAAGCTAAGGTTGCAGGTGCTGGTGC
AATACTGCGGCCTGTTTCCAGTGGTACACAGGTTGTCATGAAGAGAGCGCAAAGTATGGCCCAGGCAGCATTGTCACGACCTGCCATGCA
ACTgTCATCATGGTCATGCATGGGTCCAAGACGTCGATCCACAGCTATTCAGGTTAATTCTGAAGAACGGCAAATCTCCTGXTGGAACTT
CTTCCGGCAAAAATTCTGAAACATTCATTGTGGAATCCGAGGAGACGAGAAGTTCGACTGTGATGGAACTTCCTGTATCTTCAACCGAGG
GAGTCACGTGGAACTTGGAAATTGATCAATCTTTTGCAGATGGGATTAATATCCATAATAACCTGGATCCCGATCTTGATGATAGTGAAC
ATGGACCTGAAGACCGAATGACAGAAGTTGAGATGTGGCAACAACTAGAGCATGAACTGTATGATCAGTCTGAAGGGGAAACTGATGTCG
CGAAGGAGATTAGGGAAGAAGAAGCAGCAGCCATTGCAGAGTCAGGTCAGACCTCAAGTGAAAGCTCTGTTCCAAACACAAAGGAGGTGC
ACAGATTCTTTCCTCCTGGAAAGATAATGCATATAGTTACTCTCCTCTGTGAGGAAGTCGATCATGAAAGTGACAGCGATACGTTGAGTG
AGGACCATAACCAACCCAAGGATACAAAGGTTGGTATCTTTCTCACTCCTAGATCATTGTACAGTAAAATAAGGCTGTCACAAACTATGA
TCAGTGATCATTTCATGCCGGTTTATAGAAGGCAGATAGAGAAACTAATTANGGATCTTGAGAACAACGATGCTAGTGACAAATCAATGG
AATCTCAGGTTCAGCATCAGTGA\(3')TGGGATATTGGTTTCATATGGCATGAAAGAAAAAACTCGAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan