ESTScan Details for Unigene SGN-U250126

Score 
647
Direction 
Forward
Predicted Peptide Sequence 
TLDPSIQQSFQQLQGRPEGTRLGRPLFDILMPNLDGFMRCERKFRFKLNRIYIIFYLPVLSCLSFWYLYSAFCNYMNVQMVDDSGKQPRH
RNLNTAEDDEGYFLSNCVSTLCIYGVSVFWLLAATGLRIISVHYSRVGTSFFFGCWLALWPFWFEKINKTKVVISGDSVPPAKRVLVIAN
HRTEVDWMYLWDLALRKGCVGSIRYILKSSLMKLPVFGWVFHIMEFIPVERRWEADALKLRQILYTYKDPEDPXVACFFPEGTDFTEQKC
IRSKKYASENGLPILNNVLLPKTKGFYACLEELRGSLDAVYDITIGYKHHCPSFLDNAFGVDPAEVHMHVRCIAIVDIPEFENEAASWLK
DTFWDKEKLLFDFQFPGQFPWERIGKGAFSAQVFSNFHLCATIDCT
Predicted Coding Sequence 
XCCACATTGGATCCTTCAATTCAACAAAGTTTTCAGCAACTTCAGGGTAGGCCGGAGGGGACTAGGTTAGGGAGGCCTTTGTTTGACATT
TTGATGCCTAATCTTGATGGATTTATGAGATGTGAGAGAAAGTTCAGATTCAAGCTCAACAGAATATACATAATTTTTTACTTGCCTGTA
TTAAGTTGTTTATCTTTTTGGTACTTGTACTCTGCTTTCTGCAACTACATGAATGTTCAAATGGTTGATGATTCTGGGAAGCAACCAAGG
CACCGTAATCTXAACACCGCTGAGGATGATGAGGGGTATTTTCTGTCTAATTGTGTTAGTACTCTCTGCATTTATGGTGTTAGTGTATTT
TGGCTTTTGGCTGCTACTGGCTTGCGAATTATCAGTGTCCATTATAGCAGAGTGGGAACATCCTTCTTTTTTGGATGTTGGTTAGCTTTG
TGGCCCTTTTGGTTTGAAAAAATTAACAAAACCAAAGTGGTAATCTCTGGAGATTCTGTTCCACCTGCCAAACGAGTCTTAGTTATTGCA
AACCATCGAACTGAGGTTGATTGGATGTACTTGTGGGATCTTGCTTTGCGCAAGGGATGTGTGGGTTCAATCAGGTATATACTTAAGAGC
AGTTTGATGAAATTGCCTGTGTTTGGATGGGTTTTTCATATCATGGAGTTCATACCTGTTGAGAGAAGATGGGAGGCTGATGCATTGAAG
CTGCGTCAGATTCTTTACACCTATAAAGATCCTGAAGATCCAXCTGTGGCTTGTTTTTTTCCAGAAGGCACTGATTTCACAGAACAGAAG
TGCATTCGTAGTAAAAAATATGCTTCTGAAAACGGATTGCCAATCCTGAACAATGTACTTCTTCCAAAGACAAAGGGTTTTTATGCATGT
TTGGAGGAATTGAGAGGTTCCTTGGATGCAGTTTATGACATCACAATTGGCTACAAGCATCATTGCCCTTCTTTTTTGGACAATGCTTTT
GGGGTTGATCCAGCTGAAGTTCATATGCACGTTCGCTGTATTGCTATTGTGGATATTCCAGAATTTGAAAATGAGGCTGCTTCATGGTTG
AAGGATACCTTTTGGGACAAGGAAAAATTGCTGTTTGATTTTCAATTCCCAGGTCAATTTCCTTGGGAAAGGATTGGAAAGGGAGCGTTT
TCGGCCCAAGTGTTTAGCAACTTTCATCTTTGTGCTACCATCGACTGCACT\
Edits in Original Sequence 
(5')XCCACATTGGATCCTTCAATTCAACAAAGTTTTCAGCAACTTCAGGGTAGGCCGGtAGGGGACTAGGTTAGGGAGGCCTTTGTTTG
ACATTTTGATGCCTAATCTgTGATGGATTTATGAGATGTGAGAGAAAGTTCAGATTCAAGCTCAACAGAATATACATAATTTTTTACTTG
CCTGTATTAAGTTGTTTATCTTTTTGGTACTTGTACTCTGCTTTCTGCAACTACATGAATGTTCAAATGGTTGATGATTCTGGGAAGCAA
CCAAGGCACCGTAATCTXAACACCGCTGAGGATGATGAGGGGTATTTTCTGTCTAATTGTGTTAGTACTCTCTGCATTTATGGTGTTAGT
GTATTTTGGCTTTTGGaCTGCTACTGGCTTGCGAATTATCAGTGTCCATTATAGCAGAGTGGGAACATCCTTCTTTTTTGGATGTTGGTT
AGCTTTGTGGCCCTTTTGGTTTGAAAAAATTAACAAAACCAAAGTGGTAATCTCTGGAGATTCTGTTCCACCTGCCAAACGAGTCTTAGT
TATTGCAAACCATCGAACTGAGGTTGATTGGATGTACTTGTGGGATCTTGCTTTGCGCAAGGGATGTGTGGGTTCAATCAGGTATATACT
TAAGAGCAGTTTGATGAAATTGCCTGTGTTTGGATGGGTTTTTCATATCATGGAGTTCATACCTGTTGAGAGAAGATGGGAGGCTGATGC
ATTGAAGCTGCGTCAGATTCTTTACACCTATAAAGATCCTGAAGATCCAXCTGTGGCTTGTTTTTTTCCAGAAGGCACTGATTTCACAGA
ACAGAAGTGCATTCGTAGTAAAAAATATGCTTCTGAAAACGGATTGCCAATCCTGAACAATGTACTTCTTCCAAAGACAAAGGGTTTTTA
TGCATGTTTGGAGGAATTGAGAGGTTCCTTGGATGCAGTTTATGACATCACAATTGGCTACAAGCATCATTGCCCTTCTTTTTTGGACAA
TGCTTTTGGGGTTGATCCAGCTGAAGTTCATATGCACGTTCGCTGTATTGCTATTGTGGATATTCCAGAATTTGAAAATGAGGCTGCTTC
ATGGTTGAAGGATACCTTTTGGGACAAGGAAAAATTGCTGTTTGATTTTCAATTCCCAGGTCAATTTCCTTGGGAAAGGATTGGAAAGGG
AGCGTTTTCGGCCCAAGTGTTTAGCAACTTTCATCTTTGTGCTACCATCGACTGCACT\(3')TTGTACATATCTAACACTTTTCTCATC
CATTTGGTTCAAGATATATGTTTCCTCTGTATGTGCATACTTGATAACAGCCACATACTTCAACTTTCGACCTTCTCCCATTGTATCTTT
ATGAATGTAATTGCCTTTTATAGGGAGCCTTAATTTAGTACAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan