ESTScan Details for Unigene SGN-U250176

Score 
724
Direction 
Forward
Predicted Peptide Sequence 
NIIAESTMEDAYEFLKITRNPDGSLTRNPPVPNVPSTPEIDPNSSNQLISLSKDLPLNPAANTFIRLYRPVSPPPNAKLPLIIYFHGGGF
LLLSVSSVIFHESCNAMSAQIPALIASVEYRLAPEHRLPAAYEDAVDAIKWAKDEAINGGDPWLKEFADFSKVFLMGSSSGGNIVYHAGL
RALDINLDPIKIVGLIMNQPYFGGVKRSESELKFVNDKILPLHVNDLMWLLALPEGVDRDHEYSNPLINETKVKEKIEXVAKVFDQRYGG
DPLIDGQKEFAKMIESHGVHVTPQFLETGYHAVEIFDKKCAQDLYDSIKDFANIFVMKMWANQPWGDHLKFX
Predicted Coding Sequence 
AATATTATAGCAGAATCCACCATGGAAGATGCCTACGAGTTCCTCAAAATTACTCGAAATCCAGATGGATCTCTCACTAGAAACCCCCCA
GTTCCTAATGTCCCTTCAACCCCAGAAATTGACCCCAATTCGTCAAATCAGCTAATTTCACTTTCAAAAGACTTACCTCTTAATCCGGCC
GCCAACACCTTCATACGCCTTTATCGGCCTGTTTCTCCGCCGCCTAACGCCAAATTGCCGCTCATCATATACTTCCATGGTGGTGGATTT
TTGCTATTGAGTGTGAGTTCTGTTATTTTTCATGAATCGTGTAATGCCATGTCAGCTCAGATCCCAGCGTTGATTGCTTCCGTTGAGTAT
CGCCTCGCCCCGGAGCATCGCCTTCCCGCCGCCTATGAGGACGCCGTGGATGCTATCAAATGGGCGAAAGATGAAGCTATTAACGGTGGT
GATCCATGGTTGAAAGAGTTCGCTGATTTCTCTAAAGTTTTCTTAATGGGTAGTAGTTCCGGAGGAAATATCGTGTACCATGCAGGTCTA
CGTGCACTCGATATCAATCTCGACCCAATCAAGATCGTAGGGTTGATAATGAATCAGCCCTACTTTGGTGGGGTCAAGAGGTCGGAGTCG
GAGCTCAAGTTTGTCAATGACAAGATTTTGCCTTTGCATGTGAATGATCTGATGTGGTTGCTTGCATTGCCTGAAGGTGTGGATCGCGAT
CACGAGTATTCTAATCCGTTGATTAATGAGACGAAAGTGAAAGAGAAGATCGAACXGGTTGCCAAGGTGTTTGATCAGAGGTACGGAGGA
GATCCACTTATTGATGGGCAAAAGGAATTTGCTAAAATGATAGAGTCACATGGGGTGCACGTGACTCCTCAGTTTCTTGAAACAGGATAT
CATGCTGTGGAGATATTTGATAAAAAATGTGCACAAGATTTGTATGATTCTATAAAGGATTTTGCAAATATATTTGTGATGAAAATGTGG
GCAAATCAGCCATGGGGAGATCACTTAAAATTTGAX\
Edits in Original Sequence 
(5')AATATTATAGCAGAATCCACCATGGAAGATGCCTACGAGTTCCTCAAAATTACTCGAAATCCAGATGGATCTCTCACTAGAAACCC
CCCAGTTCCTAATGTCCCTTCAACCCCAGAAATTGACCCCAATTCGTCAAATCAGCTAATTTCACTTTCAAAAGACTTACCTCTTAATCC
GGCCGCCAACACCTTCATACGCCTTTATCGGCCTGTTTCTCCGCCGCCTAACGCCAAATTGCCGCTCATCATATACTTCCATGGTGGTGG
ATTTTTGCTATTGAGTGTGAGTTCTGTTATTTTTCATGAATCGTGTAATGCCATGTCAGCTCAGATCCCAGCGTTGATTGCTTCCGTTGA
GTATCGCCTCGCCCCGGAGCATCGCCTTCCCGCCGCCTATGAGGACGCCGTGGATGCTATCAAATGGGCGAAAGATGAAGCTATTAACGG
TGGTGATCCATGGTTGAAAGAGTTCGCTGATTTCTCTAAAGTTTTCTTAATGGGTAGTAGTTCCGGAGGAAATATCGTGTACCATGCAGG
TCTACGTGCACTCGATATCAATCTCGACCCAATCAAGATCGTAGGGTTGATAATGAATCAGCCCTACTTTGGTGGGGTCAAGAGGTCGGA
GTCGGAGCTCAAGTTTGTCAATGACAAGATTTTGCCTTTGCATGTGAATGATCTGATGTGGTTGCTTGCATTGCCTGAAGGTGTGGATCG
CGATCACGAGTATTCTAATCCGTTGATTAATGAGACGAAAGTGAAAGAGAAGATCGAACXGGTTGCCAAGGTGTTTGATCAGAgGGTACG
GAGGAGATCCACTTATTGATGGGCAAAAGGAATTTGCTAAAATGATAGAGTCACATGGGGTGCACGTGACTCCTCAGTTTCTTGAAACAG
GATATCATGCTGTGGAGATATTTGATAAAAAATGTGCACAAGATTTGTATGATTCTATAAAGGATTTTGtCAAATATATTTGTGATGAAA
ATGTGGGCAAATCAGCCATGGGGAGATCACTTAAAATTTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan