ESTScan Details for Unigene SGN-U250185

Score 
796
Direction 
Forward
Predicted Peptide Sequence 
MGTFDTAVAAFLGKICAEDESLSPCGSGGVPEKGCSRIKAAACSKEDARMSRDYEISAGPLSRRSAIISGASLISSVLLFPGEGSAVIKQ
GLLAGRVPGLSEPDEEGRLEDIPKTGDKSGGHGVGWSPMIPYTFSVPDKWEEVPVSIADLGGTEIDLRFANPKEGRVIVIVAPVKRFSDE
IGEEATIEQIGPPDKVISAFGPEVIGENVEGKVLRSEVAEHEGRTYYQFELEPPHVMITATAAGNRLYLFNVTGNGLQWKRYYKDLRKIA
ESFRVV
Predicted Coding Sequence 
ATGGGGACATTTGATACAGCAGTAGCTGCCTTTCTTGGAAAAATCTGTGCAGAGGATGAATCCCTCTCACCATGTGGTTCCGGTGGTGTT
CCAGAAAAAGGGTGTTCAAGAATTAAAGCTGCTGCTTGTTCTAAAGAAGATGCTCGTATGAGCCGGGATTATGAGATATCTGCAGGCCCA
TTGAGTAGGAGGTCAGCTATTATATCTGGTGCTTCCTTGATTTCATCAGTACTGCTTTTTCCTGGAGAGGGATCTGCTGTAATTAAACAA
GGTCTCCTAGCAGGGAGAGTTCCTGGACTGTCTGAACCAGATGAAGAAGGCAGGTTGGAGGACATACCGAAGACCGGTGACAAGTCAGGT
GGACATGGTGTTGGATGGAGTCCTATGATTCCTTATACTTTTTCCGTGCCTGATAAATGGGAAGAGGTCCCTGTGTCAATTGCTGATCTA
GGTGGTACAGAGATCGACTTGAGATTCGCAAATCCCAAAGAAGGGAGAGTCATTGTAATTGTCGCTCCTGTAAAAAGATTTTCAGATGAA
ATTGGTGAAGAAGCTACCATAGAACAAATTGGACCTCCAGATAAAGTGATTAGCGCATTTGGGCCTGAAGTCATTGGAGAGAATGTTGAA
GGTAAAGTCTTGAGATCTGAAGTCGCAGAGCATGAGGGAAGAACATATTACCAGTTTGAATTAGAGCCACCACATGTAATGATCACAGCA
ACAGCTGCTGGAAATCGCCTATACTTGTTCAATGTTACTGGAAATGGTCTTCAATGGAAAAGGTATTACAAAGATTTGAGAAAGATCGCT
GAGTCTTTCAGGGTTGTGTAA\
Edits in Original Sequence 
CTGAAGTTCCCCATATTGCATAGTTTTTTTTTGGTCACAAACCGCATTTCTTTCTCGGTTGGGAGGAA(5')ATGGGGACATTTGtATAC
AGCAGTAGCTGCCTTTCTTGGAAAAATCTGTGCAGAcGGATGAATCCCTCTCACCATGTGGTTCCGcGTGGTGTTCCAGAAAAAGGGTGT
TCAAGAATTAAAGCTGCTGCTTGTTCTAAAGAAGATGCTCGTATGAGCCGGGATTATGAGATATCTGCAGGCCCATTGAGTAGGAGGTCA
GCTATTATATCTGGTGCTTCCTTGATTTCATCAGTACTGCTTTTTCCTGGAGAGGGATCTGCTGTAATTAAACAAGGTCTCCTAGCAGGG
AGAGTTCCTGGACTGTCTGAACCAGATGAAGAAGGCAGGTTGGAGGACATACCGAAGACCGGaTGACAAGTCAGGTGGACATGGTGTTGG
ATGGAGTCCTATGATTCCTTATACTTTTTCCGTGCCTGATAAATGGGAAGAGGTCCCTGTGTCAATTGCTGATCTAGGTGGTACAGAGAT
CGACTTGAGATTCGCAAATCCCAAAGAAGGGAGAGTCATTGTAATTGTCGCTCCTGTAAAAAGATTTTCAGATGAAATTGGTGAAGAAGC
TACCATAGAACAAATTGGACCTCCAGATAAAGTGATTAGCGCATTTGGGCCTGAAGTCATTGGAGAGAATGTTGAAGGTAAAGTCTTGAG
ATCTGAAGTCGCAGAGCATGAGGGAAGAACATATTACCAGTTTGAATTAGAGCCACCACATGTAATGATCACAGCAACAGCTGCTGGAAA
TCGCCTATACTTGTTCAATGTTACTGGAAATGGTCTTCAATGGAAAAGGTATTACAAAGATTTGAGAAAGATCGCTGAGTCTTTCAGGGT
TGTGTAA\(3')TTTACACATCTACCCCATGCGTGATAGCACCTTAGCAGAGGTGGAATGCACAAGGAAGAAGAGTCAGTCAGTATAATC
ATATTTACAAGAAGCCACATCACCTCTAGTAGTATATACAGTTAAATATGTGAGAGGAGAATTTCCTTTAGAATGAGTTTTGTAACAAAT
TTTAGCTACCAATGATTATTGTAAACTGTTTACGTTACTAATATTACAAGTCTTCAGAAGGCACCTCTTCGGAAAAGATCGCGAAAAAAA
AAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan