ESTScan Details for Unigene SGN-U250220

Score 
302
Direction 
Forward
Predicted Peptide Sequence 
VQHKTIHPILCASDSQIHTQSEETETTDTNQSEPVRVNFQLNKECSFGQHFYLVGDDPMLGLWDPSNAVPLEWSEGHVWNVELDIPSGKT
ISYKFIMTVDDETILWQQGPDRIIQTWETKNTITVSEDWDNAELQTIVEEEPSAEQSTVSPEILIAENLVPQSVVDIEDDINXGKTNEVL
AIVAENITX
Predicted Coding Sequence 
GTTCAGCACAAAACTATTCACCCTATTTTGTGTGCTTCTGATTCTCAGATACATACTCAGAGTGAAGAAACAGAAACAACTGATACAAAT
CAATCTGAACCAGTTCGCGTAAACTTTCAATTGAATAAGGAATGCTCCTTTGGTCAGCATTTCTACTTAGTGGGCGATGATCCAATGCTC
GGTTTATGGGATCCATCAAATGCAGTGCCACTTGAATGGTCAGAGGGACATGTATGGAACGTCGAGTTGGATATCCCAAGTGGAAAAACT
ATCAGCTACAAGTTCATTATGACAGTAGATGATGAGACTATCTTGTGGCAACAAGGCCCTGATCGAATTATTCAAACATGGGAAACGAAG
AACACAATAACAGTTTCTGAAGATTGGGACAATGCTGAGCTGCAGACAATCGTAGAAGAGGAGCCTAGTGCAGAACAATCGACAGTTAGT
CCAGAAATTTTAATAGCTGAGAATCTGGTTCCACAATCAGTTGTAGACATAGAAGATGATATAAATGANGGAAAAACTAATGAAGTTCTA
GCTATAGTCGCGGAAAATATCACTGAX\
Edits in Original Sequence 
CACAGTTACACACAACAAACACTATATTTGTGAAGAAAAACAAAAAAAATAATCATCATTTTTATTTTCTGTTTTTCTTGAACCCCAAAT
TGAGAAAAAAGCTTCAAACTTTAGTTATGGAGTCTTTAACAGGGTTATCAATAAAAGGGGTTTGTTTGGATAAGGTTTTAGATAAACACA
AAGTTTTATCTTTGTGTAAAAAATCAGAAATTTGCTTTCTTGGATTGTCAAGTTTCAAGATTGTTCATATTACCTCATGTTCT
(5')GTT
CAGCACAAAACTATTCACCCTATTTTGTGTGCTTCTGATTCTCAGATACATACTCAGAGTGAAGAAACAGAAACAACTGATACAAATCAA
TCTGAACCAGTTCGCGTAAACTTTCAATTGAATAAGGAATGCTCCTTTGGTCAGCATTTCTACTTAGTGGGCGATGATCCAATGCTCGGT
TTATGGGATCCATCAAATGCAGTGCCACTTGAATGGTCAGAGGGACATGTATGGAACGTCGAGTTGGATATCCCAAGTGGAAAAACTATC
AGCTACAAGTTCATTATGACAGTAGATGATGAGACTATCTTGTGGCAACAAGGCCCTGATCGAATTATTCAAACATGGGAAACGAAGAAC
ACAATAACAGTTTCTGAAGATTGGGACAATGCTGAGCTGCAGACAATCGTAGAAGAGGAGCCTAGTGCAGAACAATCGACAGTTAGTCCA
GAAATTTTAATAGCTGAGAATCTGGTTCCACAATCAGTTGTAGACATAGAAGATGATATAAATGANGGAAAAACTAATGAAGTTCTAGCT
ATAGTCGCGGAAAATATCACTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan