ESTScan Details for Unigene SGN-U250277

Score 
581
Direction 
Forward
Predicted Peptide Sequence 
MKVPPAFILFPALPPPEFWSPAVVXEAKLAANTRKLYSLTVNSSNYAPFHYKDLKFSRSSSMDFSRMAIGSNVSEDTDDMFDDLLRTHGK
VVYKRNDQKPASEEIDDDAESLSFAMAVAKVASDVKAGDIKVLFVKPLVYWTRFFIIATAFSRPQIDAIGTRVRDMAEEQYGRVASGDSK
PNSWTLLDFX
Predicted Coding Sequence 
ATGAAAGTACCTCCTGCATTCATCCTCTTCCCTGCACTCCCTCCACCGGAATTTTGGTCTCCGGCGGTCGTAXCGGAAGCTAAGCTTGCT
GCTAACACCAGAAAGCTTTATTCTTTAACTGTGAATTCCTCTAATTATGCCCCATTTCATTATAAAGATCTGAAATTTTCCAGAAGCAGC
TCTATGGATTTTTCTAGAATGGCAATTGGTTCGAATGTAAGTGAAGATACAGATGACATGTTTGATGATCTCCTAAGAACGCATGGGAAA
GTGGTATACAAAAGAAATGACCAAAAACCTGCAAGTGAGGAGATTGATGATGATGCTGAAAGCCTATCCTTTGCAATGGCTGTGGCTAAA
GTTGCAAGTGATGTCAAGGCTGGAGATATAAAGGTTCTCTTTGTCAAGCCTCTAGTATATTGGACTCGGTTTTTCATTATTGCTACTGCA
TTCTCTCGCCCACAGATTGATGCCATTGGGACCAGAGTAAGAGATATGGCTGAGGAACAATATGGAAGAGTTGCTTCTGGAGATTCAAAA
CCCAACTCGTGGACGCTACTAGACTTTGXX\
Edits in Original Sequence 
AACTCTTGAGCAGTATCTTCAAAAGTTTAAATAACGAACCCCATATTGAAAA(5')ATGAAAGTACaCTCCTGCATTCATCCTCTTCCCT
GCACTCCCTCCACCGGAATTTTGGTCTCCGGCGGTCGTAXCGGAAGCTAAGCTTGCTGCTAACACCAGAAAGCTTTATTCTTTAACTGTG
AATTCCTCTAATTATGCCCCATTTCATTATAAAGATCTGAAATTTTCCAGAAGCAGCTCTATGGATTTTTCTAGAATGGCAATTGGTTCG
AATGTAAGTGAAGATACAGATGACATGTTTGATGATCTCCTAAGAACGCATGGGAAAGTGGTATACAAAAGAAATGACCAAAAACCTGCA
AGTGAGGAGATTGATGATGATGCTGAAAGCCTATCCTTTGCAATGGCTGTGGCTAAAGTTGCAAGTGATGTCAAGGCTGGAGATATAAAG
GTTCTCTTTGTCAAGCCTCTAGTATATTGGACTCGGTTTTTCATTATTGCTACTGCATTCTCTCGCCCACAGATTGATGCCATTGGGACC
AGAGTAAGAGATATGGCTGAGGAACAATATGGAAGAGTTGCTTCTGGAGATTCAAAACCCAACTCGTGGACGCTACTAGACTTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan