ESTScan Details for Unigene SGN-U250595

Score 
200
Direction 
Forward
Predicted Peptide Sequence 
MARGSSSQSTSSSTTRPGTAAPRGSAAATAGXAPTQAGASYSAGGGGGNAVVGSGNASNMLRFYTDDSPGXEDQPDCRPCDEPMLHGFVT
TLHVLGKFYRYRSGSGSGADYSGSDL
Predicted Coding Sequence 
ATGGCGCGAGGCTCTTCTTCCCAATCCACCTCCTCCTCCACCACTCGCCCAGGGACCGCCGCACCCCGTGGTTCTGCCGCCGCTACAGCT
GGTXATGCGCCGACGCAGGCTGGTGCTTCTTACTCTGCGGGCGGTGGTGGTGGTAACGCTGTAGTAGGCTCCGGCAACGCTAGCAACATG
CTTCGTTTCTATACCGATGATTCTCCAGGTXCTGAAGATCAGCCCGACTGTCGTCCTTGTGATGAGCCTATGCTTCATGGATTCGTTACT
ACTCTCCATGTCCTCGGCAAATTCTACCGCTACCGATCTGGCTCTGGCTCCGGAGCTGATTATTCGGGTTCGGATCTTTGA\
Edits in Original Sequence 
CCACCCCAAATA(5')ATGGCGCGAGGCTCTTCTTCCCAATCCACCTCCTCCTCCACCACTCGCCCAGGGACCGCCGCACCCCGTGGTTC
TGCCGCCGCTACAGCTGGTXATGCGCCGACGCAGGCTcGGTGCTTCTTACTCTGCGGGCGGTGGTGGTGGTAACGCTGTAGTAGGCTCCG
GCAACGCTAGCAACATGCTTCGTTTCTATACCGATGATTCTCCAGGTXCTGAAGATCAGCCCGACTGTCGTCCTTGTGATGAGCCTATGC
TTCATcGGATTCGTTACTACTCTCCATGTCCTCGGCAAATTCTACCGCTACCGATCTGGCTCTGGCTCCGGAGcCTGATTATTCGGGTTC
GGATCTTTGA\(3')TTTCGGATCATGGTGATTTTGAAACCCACGTCATACAGGAAAAAATTAGTTTGTTTGTTGTTTTTAATTTCAGTT
TTCGTTTCACGATCGTTTGCTGGTTCTGTTTCCGTTTTAGTTTTAGATGGCTGAATTTGACTCAGTATATTAGGAAGATGATAAAAGAAG
CTTCCAATTAAGGGAATTTTGAACGTTTACATGTGCTTTGTGTTTGTTTTAATCAGTAATGCATAGTTTTTGTTCAGAAAAGGAATATCA
ATTCGGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan