ESTScan Details for Unigene SGN-U250829

Score 
148
Direction 
Forward
Predicted Peptide Sequence 
EAYTPAVDSPRLTRFALQPPKFVEVEFENGSLYKLSAEYLRIYSPAVDSKIRSICGEKVISGRCHVGIMSAEPIGNYGVRLLFDDLHKTG
IFTWDYFYHLGSNKFTLMRNYIRTLKKHGLSRDPPREDDLKSGHEKADPHYLSWKTSSPYAQSEMVTKIVLLQIFQRLALDMLSYVQRNL
WCAXTLDLEIEHATQKRSLVSKEH
Predicted Coding Sequence 
XXCGAAGCATACACACCXGCAGTAGACTCTCCACGCCTCACCAGATTTGCTCTTCAACCTCCTAAATTTGTGGAGGTTGAGTTTGAAAAT
GGTAGTCTGTATAAGTTGTCAGCTGAGTATTTGAGAATATACAGCCCCGCTGTTGATAGTAAGATCAGATCGATTTGTGGTGAGAAGGTC
ATATCTGGTAGGTGTCATGTCGGAATTATGTCTGCAGAACCTATTGGAAATTATGGAGTGAGGTTATTGTTTGATGACTTGCATAAGACT
GGTATCTTTACATGGGACTACTTCTACCATCTTGGAAGTAACAAATTCACCCTTATGAGAAATTACATCAGAACTCTGAAGAAACATGGA
CTAAGCCGGGATCCACCTAGAGAAGATGACCTTAAGAGTGGCCATGAGAAGGCTGATCCACACTATTTAAGCTGGAAAACATCCTCCCCA
TATGCTCAGAGTGAAATGGTGACAAAAATTGTACTGTTGCAAATATTTCAAAGACTAGCTCTTGATATGCTATCATATGTTCAGCGGAAT
TTGTGGTGTGCTXATACTCTAGATCTAGAGATTGAACATGCGACACAAAAGAGGTCATTAGTTTCTAAGGAACATTAA\
Edits in Original Sequence 
(5')XXCGAAGCATACACACCXGCAGTAGACTCTCCACGCCTCACCAGATTTGCTCTTCAACCTCCTAAATTTGTGGAGGTTGAGTTTGA
AAATGGTAGTCTGTATAAGTTGTCAGCTGAGTATTTGAGAATATACAGCCCCGCTGTTGATAGTAAGATCAGATCGATTTGTGGTGAGAA
GGTCATATCTGGTAGGTGTCATGTCGGAATTATGTCTGCAGAACCTATTGGAAATTATGGAGTGAGGTTATTGTTTGATGACTTGCATAA
GACTGGTATCTTTACATGGGACTACTTCTACCATCTTGGAAGTAACAAATTCACCCTTATGAGAAATTACATCAGAACTCTGAAGAAACA
TGGACTAAGCCGGGATCCACCTAGAcGAAGATGACCTTAAGAcGTGGCCATGAGAAGGCTGATCCACACTATTTAAGCTGGAAAACATCC
TCCCCATATGCTCAGAGTGAAATGGTGACAtAAAATTGTACTGTTGCAAATATTTCAAAGACTAGCTCTTGATATGCTATCATATGTTCA
GCGGAATTTGTGGTGTGCTXATACTCTAGATCTAGAGATTGAACATGCGACACAAAAGAGGTCATTAGTTTCTAAGGAACATTAA\(3')
GGAGGCTCTTTGTTTGTAATTTTGATTTGGGATGCATGTTGGTGTTGCAGAACATGCTTGATTGAATGAAGAGAACAGTTCGTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan