ESTScan Details for Unigene SGN-U250901

Score 
513
Direction 
Forward
Predicted Peptide Sequence 
MGLWDALLNWLRSLFFQQEMELSLIGLQNAGKTSLVNVIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGNPDSAVCGKDTXRAVSA
IVYVVDAADHDNVSISRSEIHDLLSKPSLSGIPLLVLGNKIDKPGALSKQALTDQMDLKSITDREVCCYMISCKNSTNIDSVIDWLVKHS
KSKS
Predicted Coding Sequence 
ATGGGTCTTTGGGATGCTTTGCTCAATTGGCTTCGAAGCCTCTTCTTTCAGCAGGAAATGGAGCTTTCTTTGATAGGGCTGCAGAATGCA
GGAAAAACATCACTTGTAAATGTGATTGCTACTGGTGGCTACAGTGAAGATATGATACCGACGGTGGGATTTAACATGCGGAAAGTGACT
AAAGGAAATGTGACTATAAAGTTGTGGGACCTTGGAGGCAACCCAGATTCCGCAGTATGTGGGAAAGATACTGXTCGTGCAGTTTCTGCT
ATAGTTTATGTTGTTGATGCTGCTGATCATGACAATGTTAGCATTTCAAGAAGTGAAATCCATGACCTGCTGAGTAAGCCATCGTTGAGT
GGTATTCCATTGCTGGTATTGGGTAACAAGATTGACAAGCCTGGAGCCCTTTCCAAGCAGGCATTGACTGATCAGATGGACTTGAAATCT
ATAACAGATAGGGAGGTATGTTGCTATATGATATCATGCAAAAACTCCACCAATATTGACTCAGTCATTGATTGGCTTGTTAAGCACTCA
AAATCAAAGAGTTGA\
Edits in Original Sequence 
TTGAACCGAACACAAACACATTTTTTCATTTGTGAGTGAGAGCGAGAGAGATTTATATATATACATATAAATCTGCTATAAACTGACATT
TTTCAGATCTCTCGCTCTCGTCAGCT
(5')ATGGGTCTTTGGGATGCTTTGCTCAATTGGCTTCGAAGCCTCTTCTTTCAGCAGGAAATG
GAGCTTTCTTTGATAGGGCTGCAGAATGCAGGAAAAACATCACTTGTAAATGTGATTGCTACTGGTGGCTACAGTGAAGATATGATACCG
ACGGTGGGATTTAACATGCGGAAAGTGACTAAAGGAAATGTGACTATAAAGTTGTGGGACCTTGGAGGtCAACCCAGATTCCGCAGTATG
TGGGAAAGATACTGXTCGTGCAGTTTCTGCTATAGTTTATGTTGTTGATGCTGCTGATCATGACAATGTTAGCATTTCAAGAAGTGAAAT
CCATGACCTGCTGAGTAAGCCATCGTTGAGTGGTATTCCATTGCTGGTATTGGGTAACAAGATTGACAAGCCTGGAGCCCTTTCCAAGCA
GGCATTGACTGATCAGATGGACTTGAAATCTATAACAGATAGGGAGGTATGTTGCTATATGATATCATGCAAAAACTCCACCAATATTGA
CTCAGTCATTGATTGGCTTGTTAAGCACTCAAAATCAAAGAGTTGA\(3')GCCCTTTCTCCAGATCTACAAGTTAAAAGTTGTCAAGCT
ATTCCTTTTGTTGGTTTCTCCAGAGTTTTCTTGTATGTAAATTCTTTTCCCAATTGAAAGAATTGATACATGTATTATCCCAGCCTGCAA
ATTGTGTACCAATGTGTTTTTTGGGGAAGGACAACTTCTTTGATTTATTTGAAGAAACTAATTTATTATATTTTCTCTGTTTTACACCAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan