ESTScan Details for Unigene SGN-U250909

Score 
886
Direction 
Reverse
Predicted Peptide Sequence 
MKQRIKITKVNRNQETKKGVKQSGVGLLEKYRGIRKKKLPSYMAGVCVTVFLTKERGFYFAXDEEVEAGGTPGKPGMIGGKSGGRGGKSE
GGGGGGDGVKPGMSGGINGGNNEGGERGGEGIIGGIIEGGGEGNKGGNMEGGGEGMIGGIMEGGGRNGFGGRIEGGGRSGFGGKGSPPPI
GLKKFGLAAASD
Predicted Coding Sequence 
ATGAAACAGAGGATAAAAATTACCAAGGTAAACAGAAATCAAGAAACAAAGAAGGGAGTTAAACAAAGTGGAGTAGGTTTATTGGAGAAG
TACAGAGGCATAAGGAAAAAGAAGTTGCCAAGCTATATGGCAGGTGTTTGTGTAACTGTATTTTTGACTAAGGAGAGGGGTTTTTATTTT
GCAGAXGATGAAGAAGTGGAAGCTGGAGGAACACCAGGAAAACCAGGTATGATCGGTGGGAAGAGTGGAGGGAGAGGTGGGAAGAGTGAA
GGGGGCGGTGGTGGGGGAGATGGAGTTAAACCAGGTATGAGTGGTGGGATAAACGGAGGGAATAATGAAGGTGGAGAACGTGGAGGTGAA
GGGATTATTGGAGGAATTATTGAAGGTGGAGGAGAAGGGAATAAGGGAGGAAATATGGAAGGAGGAGGAGAGGGGATGATAGGAGGAATA
ATGGAAGGTGGAGGTAGAAATGGGTTTGGAGGAAGGATTGAAGGTGGTGGAAGAAGTGGATTCGGAGGCAAGGGAAGTCCTCCTCCTATT
GGATTGAAAAAATTTGGCTTAGCTGCAGCTTCTGATTGA\
Edits in Original Sequence 
TTTACCTTTTATTGAAGTAGCTTACATATCATACAATCACTTGATTTCCTATCTAATATGTCTAACAAAACATAACGAAACAAG(5')AT
GAAACAGAGGATAAAAATTACCAAGGTAAACAGAAATCAAGAAACAAAGAAGGGAGTTAAACAAAGTGGAGTAGGTTTATTGGAGAAGTA
CAGAGGCATAAGGAAAAAGAAGTTGCCAAGCTATATGGCAGGTGTTTGTGTAACTGTATTTTTGACTAAGGAGAGGGGTTTTTATTTTGC
AGAXGATGAAGAAGTGGAAGCTGGAGGAACACCAGGAAAACCAGGTATGATCGGTGGGAAGAGTGGAGGGAGAGGTGGGAAGAGTGAAGG
GGGCGGTGGTGGGGGAGATGGAGTTAAACCAGGTATGAGTGGTGGGATAAACGGAGGGAATAATGAAGGTGGAGAACGTGGAGGTGAAGG
GATTATTGGAGGAATTATTGAAGGTGGAGGAGAAGGGAATAAGGGAGGAAATATGGAAGGAGGAGGAGAGGGGATGATAGGAGGAATAAT
GGAAGGTGGAGGTAGAAATGGGTTTGGAGGAAGGATTGAAGGTGGTGGAAGAAGTGGATTCGGAGGCAAGGGAAGTCCTCCTCCTATTGG
ATTGAAAAAATTTGGCTTAGCTGCAGCTTCTGATTGA\(3')GAGTAGTATTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan