ESTScan Details for Unigene SGN-U251003

Score 
831
Direction 
Forward
Predicted Peptide Sequence 
VDHQGVYNLTKALQDYNNKLAQQRAGKSSKSKLLIAKFKSEDSLNGWEVRQGTYFQDVVVSKYDGGMDAKFEFTESGEAVFSGYVFTRGG
YVDLSRKLSLPLGYTLDRYEGLVFSVGGNGRSYVVILEAGPSADTTQSKLYFSRISTKAGFCRVRVPFSSFRPVKPDDPPLDPFLVHTLT
IRFEPRRQRPIEGPTGTNQDLRSFQLIMEYIKALPTGQETDFVLVSCTGSGIEPTRREQVLRAKRAGEDSLRRSGLGYTIIRPGPLMEEP
GGQRALIFDQGNRISQGISCADVADICVKALHDSTARNKSFDVCYEYVAEPGKELYELVAHLPDKANNYLTPALSXAGEKHMMIVLPISS
SYNLDSIPNRRYW
Predicted Coding Sequence 
GTTGATCATCAAGGGGTTTACAATCTCACCAAAGCCTTGCAGGACTACAACAATAAACTAGCACAGCAACGAGCTGGAAAGAGTAGCAAA
AGCAAGCTTTTAATTGCAAAATTCAAGTCTGAAGATTCATTGAATGGGTGGGAAGTCCGTCAGGGGACATATTTCCAGGATGTGGTTGTT
TCTAAGTATGATGGAGGAATGGATGCCAAGTTTGAGTTTACTGAAAGCGGAGAGGCTGTTTTTTCAGGGTATGTCTTCACAAGAGGAGGC
TATGTTGACTTGTCACGAAAACTCTCACTCCCTTTGGGTTACACTCTTGACAGGTATGAGGGTCTAGTATTCTCTGTTGGTGGAAATGGA
AGATCTTATGTTGTAATTCTTGAAGCTGGTCCTTCAGCAGATACAACACAAAGCAAATTGTATTTTTCCAGAATTAGCACAAAAGCAGGA
TTTTGCAGGGTGAGAGTTCCATTTTCTTCATTTCGGCCGGTGAAGCCAGATGATCCCCCATTGGATCCATTCCTTGTGCATACCTTGACC
ATACGCTTTGAGCCTAGAAGACAGAGGCCAATTGAAGGACCTACGGGGACGAACCAAGATCTGAGAAGCTTTCAGCTAATTATGGAATAT
ATTAAGGCTTTGCCTACTGGACAAGAAACTGACTTTGTCTTGGTATCATGTACGGGGTCAGGAATAGAGCCTACCAGACGGGAGCAAGTT
TTGCGAGCCAAGAGGGCTGGTGAAGATTCATTAAGAAGGTCCGGCCTTGGATACACAATTATTCGCCCAGGACCCTTGATGGAAGAACCA
GGTGGGCAACGTGCGCTCATATTTGATCAAGGAAATCGTATCTCTCAGGGAATCAGTTGTGCTGATGTGGCTGACATTTGTGTGAAGGCA
TTGCATGATTCGACAGCCAGAAACAAGAGCTTTGATGTATGTTATGAATATGTCGCTGAGCCTGGGAAGGAGTTGTACGAGTTGGTTGCA
CATTTGCCTGACAAAGCAAACAACTATTTGACACCAGCACTCTCTGXTGCTGGAGAAAAACACATGATGATCGTGCTCCCAATTAGTTCG
AGTTACAATCTTGATTCAATCCCTAACAGAAGGTATTGG\
Edits in Original Sequence 
(5')GTTGATCATCAAGGGGTTTACAATCTCACCAAAGCCTTGCAGGACTACAACAATAAACTAGCACAGCAACGAGCTGGAAAGAGTAG
CAAAAGCAAGCTTTTAATTGCAAAATTCAAGTCTGAAGATTCATTGAATGGGTGGGAAGTCCGTCAGGGGACATATTTCCAGGATGTGGT
TGTTTCTAAGTATGATGGAGGAATGGATGCCAAGTTTGAGTTTACTGAAAGCGGAGAGGCTGTTTTTTCAGGGTATGTCTTCACAAGAGG
AGGCTATGTTGACTTGTCACGAAAACTCTCACTCCCTTTGGGTTACACTCTTGACAGGTATGAGGGTCTAGTATTCTCTGTTGGTGGAAA
TGGAAGATCTTATGTTGTAATTCTTGAAGCTGGTCCTTCAGCAGATACAACACAAAGCAAATTGTATTTTTCCAGAATTAGCACAAAAGC
AGGATTTTGCAGGGTGAGAGTTCCATTTTCTTCATTTCGGCCGGTGAAGCCAGATGATCCCCCATTGGATCCATTCCTTGTGCATACCTT
GACCATACGCTTTGAGCCTAGAAGACAGAGGCCAATTGAAGGACCTACGGGGACGAACCAAGATCTGAGAAGCTTTCAGCTAATTATGGA
ATATATTAAGGCTTTGCCTACTGGACAAGAAACTGACTTTGTCTTGGTATCATGTACGGGGTCAGGAATAGAGCCTACCAGACGGGAGCA
AGTTTTGCGAGCCAAGAGGGCTGGTGAAGATTCATTAAGAAGGTCCGGCCTTGGATACACAATTATTCGCCCAGGACCCTTGATGGAAGA
ACCAGGTGGGCAACGTGCGCTCATATTTGATCAAGGAAATCGTATCTCTCAGGGAATCAGTTGTGCTGATGTGGCTGACATTTGTGTGAA
GGCATTGCATGATTCGACAGCCAGAAACAAGAGCTTTGATGTATGTTATGAATATGTCGCTGAGCCTGGGAAGGAGTTGTACGAGTTGGT
TGCACATTTGCCTGACAAAGCAAACAACTATTTGACACCAGCACTCTCTGXTGCTGGAGAAAAACACATGATGATCGTGCTCCCAATTAG
TTCGAGTTACAATCTTGATTCAATCCCTAACAGAAGGTATTGG\(3')TGTGAGACTTATCAAGATCTTTTTGACTAAGAGGAATACTTT
CTCTGTATTTGTTTTTAAATATATGTGTACATATATATATATGGCAATAGTTTTTTTTTTAATCTACTGATGGTTACGTATAAAAAAAAA
AAAAAAAAAACTGAGACTAGTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan