ESTScan Details for Unigene SGN-U251086

Score 
126
Direction 
Forward
Predicted Peptide Sequence 
LVSRFAEERERRHFLDLKAAKNFERQNGGIKQCFEFPYGPNGDLVEKFSAEMRSSLRPAYDNFIGFFHAIDWTGTLVGRSSFISRRVSSS
MYCVSEEHQFPDVFVPFCTGGVYGAERLNRILAGTGKVLRARITLIHMAFFFPHSGLGPVGYFDNNLGNTLFSFCYLIVKWKKAELRHRA
RLAATRRINNIYICCSATTKARGNAAYATSYYILSXTPTGEENSLAGYIKDFFRMNFFPDVFNIVCVQIIYLCRGEISIAFLAFIPRLRN
VAQLSFNLAMLDL
Predicted Coding Sequence 
XAGCTAGTGTCAAGATTTGCGGAAGAGAGAGAGAGGCGTCACTTTCTTGATCTCAAAGCAGCAAAGAATTTTGAGAGGCAAAATGGAGGA
ATTAAGCAGTGCTTTGAATTCCCATATGGACCAAATGGAGATCTTGTTGAGAAATTCTCTGCAGAGATGAGGTCTAGTCTTAGACCAGCA
TATGACAACTTCATAGGATTCTTCCACGCCATTGACTGGACXGGAACCTTGGTTGGTAGGTCTTCTTTCATTTCACGCCGTGTTTCTTCT
AGTATGTATTGTGTCTCGGAAGAACATCAATTTCCAGATGTTTTTGTTCCTTTTTGCACTGGAGGAGTGTATGGTGCTGAGAGGCTTAAT
CGCATATTAGCTGGAACTGGAAAAGTTTTGCGCGCCAGAATTACTTTGATTCACATGGCATTTTTCTTTCCACACTCTGGTCTGGGCCCT
GTTGGTTATTTCGATAATAATCTTGGTAATACCCTCTTTTCATTTTGCTACCTGATTGTGAAGTGGAAAAAAGCTGAACTTAGACACCGG
GCAAGACTAGCTGCAACAAGGAGGATTAACAACATATATATTTGCTGCTCTGCTACGACTAAAGCACGGGGGAATGCGGCTTATGCGACA
TCTTACTACATTCTCTCCXCTACACCAACTGGTGAAGAGAATTCCTTAGCAGGTTACATTAAGGATTTCTTTCGCATGAACTTTTTCCCX
GATGTGTTTAACATAGTTTGTGTTCAAATTATCTATCTTTGTAGAGGTGAAATCAGCATAGCCTTTCTTGCTTTTATACCCCGCCTGAGA
AACGTTGCCCAGCTTTCATTTAATCTTGCAATGTTGGATCTTTGA\
Edits in Original Sequence 
(5')XAGCTAGTGTCAAGATTTGCGGAAGAGAGAGAGAGGCGTCACTTTCTTGATCTCAAAGCAGCAAAGAATTTTGAGAGGCgAAAATG
GAGGAATTAAGCAGTGCTTTGAATTCCCATATGGACCAAATGGcAGATCTTGTTGAGAAATTCTCTGCAGAGATGAGGTCTAGTCTTAGA
CCAGCATATGACAACTTCATAGGATTCTTCCACGCCATTGACTGGACXGGAACCTTGGTTGGTAGGTCTTCTTTCATTTCACGCCGTGTT
TCTTCTAGTATGTATTGTGTCTCGGAAGAACATCAATTTCCAGATGTTTTTGTTCCTTTTTGCACTgGGAGGAGTGTATGGTGCTGAGAG
GCTTAATCGCATATTAGCTGcGAACTGGAAAAGTTTTGCGCGCCAGAATTACTTTGATTCACATGGCATTTTTCTTTCCACACTCTGGTC
TGGGCCtCTGTTGGTTATTTCGATAATAATCTTGGtTAATACCCTCTTTTCATTTTGCTACCTGATTGTGAAGTGGAAAAAAGCTGAACT
TAGACACCGGGCAAGACTAGCTaGCAACAAGGAGGATTAACAACATATATATTTGCTGCTCTGCTACGACTAAAGCACGGGGGAATGCGG
CTTATGCGACATCTTACTACATTCTCTCCXCTACACCAACTGGTGAAGAGAATTCCTTAGCAcGGTTACATTAAGGATTTCTTTCGCATG
AACTTTTTCCCXGATGTGTTTAACATAGTTTGTGTTCAAATTATCTATCTTTGTAGAGGTGAAATCAGCATAGCCTTTCTTGCTTTTATA
CCCCGCCTGAGAAACGTTGCCCAGCTTTCATTTAATCTTGCAATGTTGGATCTTTGA\(3')ATTTCTTATATCAAAATTCAATTGAGTC
TCTGCAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan