ESTScan Details for Unigene SGN-U251243

Score 
587
Direction 
Forward
Predicted Peptide Sequence 
MAEPKVKYDRQLRIWGEQGQAALEKASICLLNCGPTGSETLKNLVLGGVGSITIVDGSKVEVGDLGNNFMVDESSVGQSKAEACXAFLQE
LNDAVKAKFIEEHPEELIETNPSFFSQFTLVIATQLVEDSMVKLDRICREANIILIFARSYGLMGLVRISVKEHTVIESKPDHFLDDLRL
NDPWPELGGLQRQ
Predicted Coding Sequence 
ATGGCGGAACCCAAAGTCAAATATGATCGTCAGCTCAGGATATGGGGTGAGCAAGGACAAGCTGCACTGGAGAAAGCCAGTATCTGCTTA
CTTAACTGTGGTCCAACTGGTTCTGAAACTTTGAAAAATCTTGTTCTTGGTGGGGTGGGAAGCATCACTATTGTTGATGGTTCTAAGGTT
GAAGTGGGTGATCTTGGAAATAATTTTATGGTTGATGAATCAAGTGTTGGACAGTCTAAGGCAGAGGCGTGTGXTGCATTTCTTCAAGAG
TTAAATGATGCTGTTAAAGCCAAGTTTATAGAAGAACATCCAGAGGAACTAATTGAGACTAATCCATCATTCTTTTCTCAGTTTACCTTG
GTCATAGCTACACAGTTGGTTGAAGATTCCATGGTGAAATTGGATCGAATCTGTCGGGAGGCAAATATTATTTTAATATTTGCACGATCA
TATGGCCTCATGGGTCTTGTCAGGATCAGTGTGAAGGAACATACAGTAATTGAATCAAAGCCTGACCATTTCTTAGATGATCTACGGCTT
AATGACCCATGGCCAGAACTTGGAGGTTTGCAGAGACAGTAG\
Edits in Original Sequence 
CCCAGTACCAAGTTCTTCACTCTCTCTATCAGTCTTCTCACATATACAACA(5')ATGGCGGAACCCAAAGTCAAATATGATCGTCAGCT
CAGGATATGGGGTGAGCAAGGACAAGCTGCACTGGAGAAAGCCAGTATCTGCTTACTTAACTGTGGTCCAACTGGTTCTGAAACTTTGAA
AAATCTTGTTCTTGGTGGGGTGGGAAGCATCACTATTGTTGATGGTTCTAAGGTTGAAGTGGGTGATCTTGGAAATAATTTTATGGTTGA
TGAATCAAGTGTTGGACAGTCTAAGGCAGAGtGCGTGTGXTGCATTTCTTCAAGAGTTAAATGATGCTGTTAAAGCCAAGTTTATAGAAG
AACATCCAGAGGAACTAATTGAGACTAATCCATCATTCTTTTCTCAGTTTACCTTGGTCATAGCTACACAGTTGGTTGAAGATTCCATGG
TGAAATTGGATCGAATCTGTCGGGAGGCAAATATTATTTTAATATTTGCACGATCATATGGCCTCATGGGTCTTGTCAGGATCAGTGTGA
AGGAACATACAGTAATTGAATCAAAGCCTGACCATTTCTTAGATGATCTACGGCTTAATGACCCATGGCCAGAACTTcGGAGGTTTGCAG
AGACAGTAG\(3')ACTTAAACACAAACTGATGCTGTAGTACATAAACACACACCATATATTATTATCCTTGTTAAGATGGCAGAGGAAT
GGGCAAATACGCATGGTGGAAAGCTTCCTTCTACCAGAGAAGAGAAAAACAATTCAAAGATTTGATTAAATCCAAGATGATCANCGTGGA
TGAAGAAACTATAAAGAACCATGGATGCATCATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan