ESTScan Details for Unigene SGN-U251344

Score 
264
Direction 
Forward
Predicted Peptide Sequence 
SAVTGFAAEATRIKGSQVQVPTPTECVYPRSPALGLGLTASVALMVAQIIINVAVDVSAAGKANINXASNWTLALICFVVSWFTFVIAFL
LLLTGAALNDQHGDESLYFGNYYCYVVKPGVFAGAAILSLASVALGITYYLSLTSAKNINDPWRPPAPSQGGIAMGHPQFPSQTSQEPVF
VHEDTYXETHIYMIVPRXHINMRNGGVKGVKNRLPYVKHSPL
Predicted Coding Sequence 
TCTGCCGTTACTGGTTTTGCTGCTGAGGCCACAAGGATTAAGGGTTCTCAGGTCCAGGTTCCGACTCCTACAGAATGTGTATATCCAAGG
AGTCCTGCACTGGGTCTTGGATTGACTGCTTCTGTGGCTCTTATGGTTGCTCAAATAATTATCAATGTAGCAGTGGATGTGTCTGCTGCC
GGAAAGGCCAACATCAATXCAGCATCTAATTGGACGCTAGCACTAATATGTTTTGTTGTATCCTGGTTTACATTTGTTATAGCATTTCTA
TTGTTGCTAACAGGCGCAGCACTAAATGATCAGCATGGTGACGAGAGCCTGTATTTCGGCAACTACTATTGCTATGTTGTAAAGCCTGGA
GTATTTGCTGGAGCTGCTATCTTGTCCCTTGCCAGTGTTGCTCTTGGAATCACCTATTATCTTTCCTTGACATCTGCAAAGAACATCAAC
GATCCATGGCGTCCACCAGCTCCAAGTCAAGGTGGCATTGCAATGGGACACCCACAATTTCCTTCACAGACCAGTCAGGAGCCAGTTTTT
GTGCATGAAGATACTTATXATGAGACGCATATCTACATGATTGTCCCTAGACXCCATATAAACATGAGGAATGGAGGTGTTAAGGGTGTX
AAGAATCGTCTTCCGTATGTGAAACACTCTCCTTTGTGA\
Edits in Original Sequence 
AAAATTCACAAGCTTTACATTGCTTCCTCTCTACACTTTCCCCTTTGCCCCCTTTTTCTTCTTCTTTTCTGTTTGCTGCTCTTTTTTTAA
CAGTGAAAAAGATCAGTTTTTGAGTGACACCAACAGTCTAAAACAAGAAAGAAAGAGTTGCTATGGAGAGAAAATCGATAATAATTTGTG
GGGTTGTGGGATTTCTAGGGCTATTA
(5')TCTGCCGTTACTGGTTTTGCTGCTGAGGCCACAAGGATTAAGGGTTCTCAGGTCCAGGTT
CCGACTCCTACAGAATGTGTATATCCAAGGAGTCCTGCACTGGGTCTTGGATTGACTGCTTCTGTGGCTCTTATGGTTGCTCAAATAATT
ATCAATGTAGCaAGTGGATGTGTCTGCTGCCGGAAAGGCCAACATCAATXCAGCATCTAATTGGACGCTAGCACTAATATGTTTTGTTGT
ATCCTGGTTTACATTTGTTATAGCATTTCTATTGTTGCTAACAGGCGCAGCACTAAATGATCAGCATGGTGACGAGAGCCTGTATTTCGG
CAACTACTATTGCTATGTTGTAAAGCCTGGAGTATTTGCTGGAGCTGCTATCTTGTCCCTTGCCAGTGTTGCTCTTGGAATCACCTATTA
TCTTTCCTTGACATCTGCAAAGAACATCAACGATCCATGGCGTCCACCAGCTCCAAGTCAAGGTGGCATTGCAATGGGACACCCACAATT
TCCTTCACAGACCAGTCAGGAGCCAGTTTTTGTGCATGAAGATACTTATXATGAGACGCATATCTACATGATTGTCCCTAGACXCCATAT
AAACATGAGGAATGGAGGTGTTAAGGGTGTXAAGAATCGTCTTCCGTATGTGAAACACTCTCCTTTGTGA\(3')GCTATATCATACTAT
TTTTTTTGTTTTTTCATTTGCTATGGCAGTGATAGCTTAATTTTGTCGGAAATTTGTAGCCTGTAGCATGTATCTGGAGGTGATGTGTGT
ATGTAATCCAACAATGCAACATACTCTTGTATGAACTCTGTAGTTTCGAATAGCTATCATTAGTAATGGTTCTTGAAAANNAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan