ESTScan Details for Unigene SGN-U251397

Score 
838
Direction 
Forward
Predicted Peptide Sequence 
MTMSSSSFMRQLSGKEGWKSTSKRWGGGGGGNWKQMEAGFNNMCGGGNGYNGGVGYEEESNGGGGSKFTYKAAMMWALTHVTNKGDILTL
LHIVPHSSSSSSSHCANNKGFSSDSSSSSAAHLASSLGSLCKACKPEVEVEALVIQGPKMATVMSQVKKLEVSVLVLGQKKPSSSLAVCV
GGAVKRNLWNNASTLGLFDNRSKEAKPXAWEDTLSALDGRRISGSWPKFLI
Predicted Coding Sequence 
ATGACTATGAGTTCGAGTTCATTTATGAGGCAACTGAGTGGGAAAGAAGGGTGGAAATCGACGTCGAAGAGATGGGGTGGTGGGGGTGGA
GGAAATTGGAAGCAAATGGAAGCTGGATTTAACAATATGTGTGGAGGAGGAAATGGGTATAATGGTGGXGTTGGTTATGAGGAAGAGAGT
AATGGTGGTGGTGGATCAAAGTTCACATACAAAGCTGCTATGATGTGGGCTCTTACACATGTTACTAATAAAGGAGATATACTCACACTT
CTTCACATTGTACCTCATTCTTCGTCTTCATCTTCTTCTCATTGTGCTAATAATAAGGGCTTTTCTTCTGATTCATCTTCTTCATCTGCT
GCTCATCTTGCTAGTTCCCTTGGATCTCTGTGCAAGGCTTGTAAACCTGAAGTTGAAGTGGAAGCACTAGTAATACAAGGACCAAAAATG
GCAACAGTAATGAGCCAAGTGAAGAAGCTGGAGGTGTCTGTGTTAGTCTTGGGTCAGAAAAAACCCTCTTCTTCTTTAGCTGTCTGTGTG
GGAGGAGCAGTGAAGAGGAATTTGTGGAACAATGCATCAACACTTGGATTGTTTGACAATAGGAGTAAGGAAGCAAAGCCAGXGGCATGG
GAGGATACCTTATCAGCACTAGATGGCAGAAGAATTTCTGGCTCTTGGCCTAAGTTTTTAATTTAG\
Edits in Original Sequence 
CTTTATAGCACTTTCTTGTGTTGAATGAACAAAAACAAGTTGATATACATGTTTTGAGGTTGAGTTTATATACAGTGAAAA(5')ATGAC
TATGAGTTCGAGTTCATTTATGAGGCAACTGAGTGGGAAAGAAGGGTGGAAATCGACGTCGAAGAGATGGGGTGGTGGGGGTGGAGGAAA
TTGGAAGCAAATGGAAGCTGGATTTAACAATATGTGTGGAGGAGGAAATGGGTATAATGGTGGXGTTGGTTATGAGGAAGAGAGTAATGG
TGGTGGTGGATCAAAGTTCACATACAAAGCaTGCTATGATGTGGGCTCTTACACATGTTACTAATAAAGGAGATATACTCACACTTCTTC
ACATTGTACCTCATTCTTCGTCTTCATCTTCTTCTCATTGTGCTAATAATAAGGGCTTTTCTTCTGATTCATCTTCTTCATCTGCTGCTC
ATCTTGCTAGTTCCCTTGGATCTCTGTGCAAGGCTTGTAAACCTGAAGTTGAAGTGGAAGCACTAGTAATACAAGGACCAAAAATGGCAA
CAGTAATGAGCCAAGTGAAGAAGCTGGAGGTGTCTGTGTTAGTCTTGGGTCAGAAAAAACCCTCTTCTcTCTTTAGCTGTCTGTGTGGGA
GGAGCAGTGAAGAGGAATTTGTGGAACAATGCATCAACACaTTGGATTGTTTGACAATAGGAGTAAGGAAGCAAAGCCAGXGGCATGGGA
GGATACCTTATCAGCACTAGATGGCAGAAGAATTTCTGGCTCTTGGCCTAAGTTTTTAATTTAG\(3')TTTAGGAATTAATATTACTCA
CTCTAATATGGATAATAATTTGTGTAGAGAGCTTTCAGTACTAGTATTTCCTATGTAGCATTCCCTAAAAAACAAAAAATTACTCTTCTG
GTGTGTAATTTTATATATATAAATATATCTAAATGCTAACTGAGAAGTTGTTATTTGTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan