ESTScan Details for Unigene SGN-U251622

Score 
407
Direction 
Forward
Predicted Peptide Sequence 
LTEVKSPKPEALRNGGRQRIFPCSSTSNCTELNAFGFAIAAERRRSTGTLHDDIVTNRTYCVYTSDVATGYGVGAFLFLLSGEALLMGVT
KCMCFGRPLSPGSNRAWTIIYFVSSWLTFLVAEACVVAGAKQNAYHTKYRDMLLAENFSCETLRKGVFVAGAVFIVANMILNVYFYMYFT
KATTQPAHKTNRSSSNIGMAGYA
Predicted Coding Sequence 
XTCTTAACTGAAGTGAAAAGCCCTAAACCXGAAGCTTTGAGAAATGGCGGAAGGCAGAGGATCTTCCCTTGTTCATCTACTAGTAATTGT
ACTGAGCTTAATGCTTTCGGATTCGCCATTGCCGCCGAACGTCGCCGGAGCACTGGTACTCTGCATGATGATATTGTTACCAATCGTACA
TATTGTGTTTACACCTCAGACGTTGCCACTGGATATGGAGTAGGTGCTTTCTTGTTTCTTCTTTCAGGCGAGGCATTGCTTATGGGAGTA
ACAAAATGCATGTGCTTCGGAAGACCTTTATCTCCTGGTTCAAATCGTGCATGGACCATTATATACTTCGTATCATCATGGCTGACATTC
CTGGTTGCTGAGGCATGTGTTGTTGCTGGAGCAAAGCAAAATGCATACCACACCAAGTATCGTGATATGCTCTTAGCAGAAAACTTCTCT
TGCGAAACGCTAAGGAAAGGTGTCTTTGTTGCTGGAGCAGTCTTTATCGTTGCAAACATGATCCTTAATGTGTATTTCTACATGTATTTC
ACTAAGGCTACTACTCAGCCAGCTCACAAGACAAATCGTAGTAGCTCAAATATCGGGATGGCTGGTTATGCATAG\
Edits in Original Sequence 
(5')XTCTTAACTGAAGTGAAAAGCCCTAAACCXGAAGCTTTGAGAAATGGCGGAAGGCAGAGGATCTTCCCTTGTTCATCTACTAGTAA
TTGTACTGAGCTTAATcGCTTTCGGATTCGCCATTGCCGCCGAACGTCGCCGGAGCACTGGTACTCTGCATGATGATATTGTTACCAATC
GTACATATTGTGTTTACACCTCAGACGTTGCCACTGGATATGGAGTAGGTGCTTTCTTGTTTCTTCTTTCAGGCGAGGCATTGCTTATGG
GAGTAACAAAATGCATGTGCTTCGGAAGACCTTTATCTCCTGGTTCAAATCGTGCATGGACCATTATATACTTCGTATCATCATGGCTGA
CATTCCTGGTTGCTGAGGCATGTGTTGTTGCTGGAGCAAAGCAAAATGCATACCACACCAAGTATCGTGATATGCTCTTAGCAGAAAACT
TCTCTTGCGAAACGCTAAGGAAAGGTGTCTTTGTTGCTGGAGCAGTCTTTATCGTTGCAAACATGATCCTTAATGTGTATTTCTACATGT
ATTTCACTAAGGCTACTACTCAGCCAGCTCACAAGACAAATCGTAGTAGCTCAAATATCGGGATGGCTGGTTATGCATAG\(3')ATTTT
GCAGAAAAACATTAGCTAGGCTCTATATTACCTACATCATTGACACTTCGGTTGTATAATGTACTACATATAAGTTTGTCTATTATATTA
AATCTGTTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan