ESTScan Details for Unigene SGN-U251671

Score 
204
Direction 
Forward
Predicted Peptide Sequence 
RGKLNHMNTPDFVKEFEKEHEVNWLDIHSRIRNMIKSAFEAAAAVHPEMHHSKSRAMYGVDVMLDSHFQPKLLEITYCPDCTRAVTYDTE
AVVGGGETVKGKEFYNYIFGCLFLNETNHXFPIVSGTRACRGFCLNLHAKVELLSCASVSRENTSKLALNVIYGNSLSCLDFRALVCHTA
KELCRTATSTSALFPKSLAVRESSYLHGLLSYFPCNXRVLKTLPQNSQNNFSXSVACNMVKNMFSEGKSVAKKSNAVRFKKRGGP
Predicted Coding Sequence 
XACAGAGGCAAGTTGAACCATATGAACACACCAGATTTTGTAAAAGAATTTGAGAAAGAACATGAGGTCAACTGGCTGGATATCCACTCA
AGGATTAGAAATATGATCAAATCGGCTTTTGAAGCAGCAGCTGCTGTGCATCCAGAAATGCATCATAGCAAATCTAGGGCAATGTATGGG
GTTGATGTCATGCTTGATAGCCATTTTCAGCCTAAATTATTGGAGATTACCTACTGCCCAGACTGTACTAGGGCAGTCACATATGACACT
GAAGCTGTCGTCGGTGGAGGAGAAACTGTTAAAGGAAAAGAGTTCTACAACTATATCTTTGGCTGTCTATTTCTAAATGAAACTAATCAT
GXTTTCCCAATTGTGAGTGGAACCCGGGCATGTAGAGGTTTTTGCCTTAATTTGCATGCCAAAGTAGAACTCTTGAGTTGTGCAAGTGTA
TCAAGAGAAAATACAAGCAAACTGGCGTTGAATGTAATCTATGGAAATAGTCTGAGTTGTTTGGATTTTAGAGCTTTAGTTTGTCACACT
GCCAAGGAGCTATGCAGAACTGCCACATCAACCTCTGCXCTCTTCCCCAAGTCTCTTGCAGTCAGAGAATCATCATATCTCCATGGTCTA
TTGAGTTATTTCCCCTGTAATTTXAGAGTCTTGAAAACACTCCCGCAAAATTCGCAGAATAATTTTTCAXCATCTGTAGCCTGTAACATG
GTTAAAAACATGTTTTCCGAGGGTAAATCAGTTGCAAAAAAGTCTAATGCCGTACGGTTTAAAAAAAGGGGGGGCCCX\
Edits in Original Sequence 
(5')XACAGAGGCAAGTTGAACCATATGAACACACCAGATTTTGTAAAAGAATTTGAGAAAGAACATGAGGTCAACTGGCTGGATATCCA
CTCAAGGATTAGAAATATGATCAAATCGGCTTTTGAAGCAGCAGCTGCTGTGCATCCAGAAATGCATCATAGCAAATCTAGGGCAATGTA
TGGGGTTGATGTCATGCTTGATAGCCATTTTCAGCCTAAATTATTGGAGATTACCTACTGCCCAGACTGTACTAGGGCAGTCACATATGA
CACTGAAGCTGTCGTCGGTGGAGGAGAAACTGTTAAAGGAAAAGAGTTCTACAACTATATCTTTGGCTGTCTATTTCTAAATGAAACTAA
TCATGXTTTCCCAATTGTGAGTGGAACCCGGGCATGTAGAGGTTTTTGCCTTAATTTGCATGCCAAAGTAGAACTCTTGAGTTGTGCAAG
TGTATCAAGAGAAAATACAAGCAAACTGGCGTTGtAATGTAATCTATGGAAATAGTCTGAGTTGTTTGGATTTTAGAGCTTTAGTTTGTC
ACACTGCCAAGGAGCTATGCAGAACTGCCACATCAACCTCTGCXCTCTTCCCCAAGTCTCTTGCAGTCAGAGAATCATCATATCTCCATG
GTCTATTGAGTTATTTCCCCTGTAATTTXAGAGTCTTGAAAACACTCCCGCAtAAATTCGCAGAATAATTTTTCAXCATCTGTAGCCTGT
aAACATGGTTAAAAACATGTTTTCCGAGGGTAAATCAGTTGCAAAAAAGTCTAATGCCGTACGGTTTAAAAAAAGGGGGGGCCCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan