ESTScan Details for Unigene SGN-U251721

Score 
930
Direction 
Forward
Predicted Peptide Sequence 
YQLEKKFFPDQGFDKAFLDPGQSNENVKRSKKKLGKKENIIEKDIDGGDGKSLIFFEEEEKSVSSETKEEAKVDVSEKKVEEFFKCLKKV
PNKENGVASAEPFLATRSTGLPPKWDSPGGTVVLVNKPKGWTSFTVCGKLRRLTKVKKVGHAGTLDPMATGLLIVCVGRSTKIVDSYQGM
MKGYSGISVWEKPPLPXDADSPVIQRDPWEHIKDEDIKKTAASFLERYGKXPPMFSAIKVGGEKMYDKARRGESIELAPRRISIFEFDVK
RSLDDRQNVIFRVRCSKGTYVRSLCADFGKALGSCAHLTALRRDSIGEYTADDAWEFQELEEAITKGYLKILFEITWAELSSTCAGEKLQ
VSAEKRCPQAGLDTTITEETVLGKSSFLVAIGDXIHIYVLSSYLNKEIIVFSPSPHYLFPWPPILLRFW
Predicted Coding Sequence 
TATCAATTGGAGAAGAAGTTTTTTCCCGATCAGGGTTTTGATAAGGCTTTTCTTGATCCTGGGCAGTCGAATGAGAATGTAAAGAGGAGT
AAAAAGAAATTGGGGAAGAAGGAAAATATAATAGAAAAAGATATTGATGGTGGGGATGGTAAAAGTTTGATCTTTTTCGAAGAGGAAGAA
AAAAGTGTCAGCTCTGAAACTAAAGAGGAAGCTAAAGTTGATGTATCGGAAAAGAAAGTGGAAGAGTTCTTCAAGTGTTTGAAGAAAGTT
CCAAATAAGGAAAATGGTGTTGCCAGTGCCGAGCCATTTCTAGCGACAAGGAGTACAGGGCTTCCTCCTAAATGGGATAGTCCGGGTGGG
ACTGTTGTATTAGTGAACAAACCAAAAGGTTGGACTTCTTTTACTGTTTGTGGAAAGTTGCGTCGCTTAACAAAAGTGAAAAAGGTTGGC
CATGCTGGAACACTTGATCCTATGGCAACTGGCTTATTGATTGTATGTGTTGGTAGATCTACGAAGATCGTTGACAGCTATCAGGGTATG
ATGAAGGGCTACAGTGGAATCTCCGTTTGGGAGAAGCCACCTCTACCTGXNGATGCAGATTCCCCGGTTATTCAACGAGATCCATGGGAG
CATATCAAGGATGAGGACATAAAGAAAACGGCAGCATCCTTTTTGGAGAGATATGGCAAGXTCCCTCCGATGTTCTCAGCAATCAAAGTT
GGTGGTGAAAAGATGTATGATAAAGCAAGAAGAGGAGAAAGCATCGAACTTGCACCGAGAAGGATTTCAATTTTCGAATTTGACGTGAAG
CGGAGTTTAGATGACAGACAGAATGTGATTTTCCGAGTAAGATGCTCAAAAGGTACCTATGTCCGATCACTTTGTGCAGACTTCGGGAAA
GCTCTTGGCAGTTGTGCTCACTTGACAGCTCTGCGACGAGATTCAATTGGAGAGTATACAGCGGATGATGCTTGGGAATTTCAAGAATTG
GAAGAGGCAATCACCAAAGGATATTTGAAGATTCTTTTTGAGATTACATGGGCAGAGTTATCCAGTACATGTGCTGGTGAGAAGCTGCAG
GTATCAGCAGAAAAGAGATGCCCACAGGCTGGCCTGGACACCACCATTACAGAAGAAACAGTTCTTGGAAAATCCTCATTTTTGGTGGCA
ATTGGAGATXCTATACATATTTATGTTCTGTCTAGCTACCTCAACAAAGAGATAATAGTATTTTCACCTTCTCCACATTACCTCTTTCCT
TGGCCCCCAATTTTGCTTCGTTTCTGG\
Edits in Original Sequence 
(5')TATCAATTGGAGAAGAAGTTTTTTCCCGATCAGGGTTTTGATAAGGCTTTTCTTGATCCTGGGCAGTCGAATGAGAATGTAAAGAG
GAGTAAAAAGAAATTGGGGAAGAAGGAAAATATAATAGAAAAAGATATTGATGGTGGGGATGGTAAAAGTTTGATCTTTTTCGAAGAGGA
AGAAAAAAGTGTCAGCTCTGAAACTAAAGAGGAAGCTAAAGTTGATGTATCGGAAAAGAAAGTGGAAGAGTTCTTCAAGTGTTTGAAGAA
AGTTCCAAATAAGGAAAATGGTGTTGCCAGTGCCGAGCCATTTCTAGCGACAAGGAGTACAGGGCTTCCTCCTAAATGGGATAGTCCGGG
TGGGACTGTTGTATTAGTGAACAAACCAAAAGGTTGGACTTCTTTTACTGTTTGTGGAAAGTTGCGTCGCTTAACAAAAGTGAAAAAGGT
TGGCCATGCTGGAACACTTGATCCTATGGCAACTGGCTTATTGATTGTATGTGTTGGTAGATCTACGAAGATCGTTGACAGCTATCAGGG
TATGATGAAGGGCTACAGTGGAATCtTCCGTTTGGGAGAAGCCACCTCTACCTGXNGATGCAGATTCCCCGGTTATTCAACGAGATCCAT
GGGAGCATATCAAGGATGAGGACATAAAGAAAACGGCAGCATCCTTTTTGGAGAGATATGGCAAGXTCCCTCCGATGTTCTCAGCAATCA
AAGTTGGTGGTGAAAAGATGTATGATAAAGCAAGAAGAGGAGAAAGCATCGAACTTGCACCGAGAAGGATTTCAATTTTCGAATTTGACG
TGAAGCGGAGTTTAGATGACAGACAGAATGTGATTTTCCGAGTAAGATGCTCAAAAGGTACCTATGTCCGATCACTTTGTGCAGACTTCG
GGAAAGCTCTTGGCAGTTGTGCTCACTTGACAGCTCTGCGACGAGATTCAATTGGAGAGTATACAGCGGATGATGCTTGGGAATTTCAAG
AATTGGAAGAGGCAATCACCAAAGGATATTTGtAAGATTCTTTTTGAGATTACATGGGCAGAGTTATCCAGTACATGTGCTGGTGAGAAG
CTGCAGGTATCAGCAGAAAAGtAGATGCCCACAGGCTGGCCTGGACACCACCATTACAGAAGAAACAGTTCTTGGAAAATCCTCATTTTT
GGTGGCAATTGGAGATXCTATACATATTTATGTTCTGTCTAGCTACCTCAACAAAGAGATAATAGTATTTTCACCTTCTCCACATTACCT
CTTTCCTTGGCCCCCAATTTTGCTTCGTTTCTGG\(3')GCGAAAGTGGTGTTAGAACCTTTTATAACATATAGATTAGGATGAGTTGTA
ATATATCTTTGTATTTCAAGAAATGCTGGGAATCAAAAGATTTGTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan