ESTScan Details for Unigene SGN-U252284

Score 
761
Direction 
Forward
Predicted Peptide Sequence 
RERELGDPPPKQKLLSENENARNRSPSPSRSDAKHDDDQPKVDKLSLKRKGIGSEARAERMANANTDLQLLSGPERERQLLKQKKRGRKG
HEEDMLAKLEKFKAGLSAKANESANAVKEEELSDWAAVTLKFTPEPGKDKMSRSEDPNDYVVHDPLLEKGKEKFNKMMAKQNDEKENGLA
NLLLXADLPAEETMELLSVKLFGIHIEXGKDVGSSLCEAKSFVLGQTSLLKVWHFDYQYPLPKEVTDXAKSKCSSGVVTLPVL
Predicted Coding Sequence 
XXGAGAGAGAGAGAACTAGGCGATCCGCCACCCAAACAGAAGTTGCTCAGTGAGAATGAGAATGCAAGAAATCGTTCACCATCTCCTTCA
AGGTCTGATGCTAAACATGATGATGACCAGCCAAAAGTGGATAAGTTGTCTCTAAAGAGAAAAGGTATAGGATCTGAAGCAAGAGCTGAA
CGTATGGCCAATGCAAATACAGACTTACAGTTGTTGTCTGGCCCTGAACGAGAAAGACAGCTGCTAAAGCAAAAGAAACGAGGACGAAAA
GGACACGAAGAAGACATGCTAGCAAAATTGGAGAAATTTAAGGCTGGACTGTCTGCTAAAGCCAATGAATCTGCTAATGCGGTCAAGGAG
GAAGAATTATCTGATTGGGCAGCAGTTACATTAAAATTCACTCCTGAACCTGGAAAGGACAAAATGTCTCGTAGTGAGGACCCCAATGAT
TATGTGGTACACGATCCTTTGTTGGAGAAAGGGAAAGAGAAGTTCAATAAAATGATGGCAAAGCAAAACGACGAGAAAGAGAATGGGCTG
GCAAATCTCTTACTTGXAGCTGATCTTCCAGCTGAAGAAACGATGGAATTGCTATCTGTGAAGTTATTCGGCATTCATATTGAAGAXGGC
AAAGATGTTGGTTCCTCTCTTTGTGAAGCAAAGAGCTTTGTACTGGGCCAAACTAGTTTGCTGAAAGTATGGCATTTTGATTATCAATAT
CCTCTTCCCAAAGAAGTTACAGATGXTGCCAAATCAAAGTGTTCTTCTGGTGTTGTTACTTTGCCTGTCCTGTGA\
Edits in Original Sequence 
(5')XXGAGAGAGAGAGAACTAGGCGATCCGCCACCCAAACAGAAGTTGCTCAGTGAGAATGAGAATGCAAGAAATCGTTCACCATCTCC
TTCAAGGTCTGATGCTAAACATGATGATGACCAGCCAAAAGTGGATAAGTTGTCTCTAAAGAGAAAAGGTATAGGATCTGAAGCAAGAGC
TGAACGTATGGCCAATGCAAATACAGACTTACAGTTGTTGTCTGGCCCTGAACGAGAAAGACAGCTGCTAAAGCAAAAGAAACGAGGACG
AAAAGGACACGAAGAAGACATGCTAGCAAAATTGGAGAAATTTAAGGCTGGACTGTCTGCTAAAGCCAATGAATCTGCTAATGCGGTCAA
GGAGGAAGAATTATCTGATTGGGCAGCAGTTACATTAAAATTCACTCCTGAACCTGGAAAGGACAAAATGTCTCGTAGTGAGGACCCCAA
TGATTATGTGGTACACGATCCTTTGTTGGAGAAAGGGAAAGAGAAGTTCAATAAAATGATGGCAAAGCAAAAgCGACGAGAAAGAGAATG
GGCTGGCAAATCTCTTACTTGXAGCTGATCTTCCAGCTGAAGAAACGATGGAATTGCTATCTGTGAAGTTATTCGGCATTCATATTGAAG
AXGGCAAAGATGTTGGTTCCTCTCTTTGTGAAGCAAAGAGCTTTGTACTGGGCCAAACTAGTTTGCTGAAAGTATGGCATTTTGATTATC
AATATCCTCTTCCCAAAGAAGTTACAGATGXTGCCAAATCAAAGTGTTCTTCTGGTGTTGTTACTTTGCCTGTCCTGTGA\(3')TATTT
TTCTTTTATTTAAAATGGACAGGAAAAGTGTACCAATATACTTTTGGTTTCAATGGAATGTGGAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan