Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

Due to a hardware issue, SGN was briefly unavailable earlier today. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U252506

Score 
556
Direction 
Forward
Predicted Peptide Sequence 
MARPSWLVDSRRIATKIKSASGDPATVNWKSNPTKACPNCQFIIDNNDVSHDWPGLPRGVKFDPTDQEIIWHLLGKVEGGDRNSHPFIDE
FIPTVDEDDGICYTHPQNLPGVKQDGSVSHFFHRAIKAYNTGTRKRRKIHGDNSGDVRWHKTGRTKPVILDGIQRGCKKIMVLYISPSKG
GKAEKTNWVMHQYHLRTGEDEREGEYVVSKVFYQQQQSSRGEK
Predicted Coding Sequence 
ATGGCTAGGCCATCATGGTTAGTTGACAGTAGGAGGATTGCAACAAAAATCAAGAGTGCATCAGGTGATCCTGCTACAGTGAATTGGAAG
AGCAACCCTACAAAAGCTTGCCCTAATTGCCAGTTTATCATTGACAATAATGACGTCAGCCATGACTGGCCAGGATTGCCAAGAGGTGTA
AAATTTGATCCAACTGATCAAGAGATTATTTGGCACTTACTTGGAAAAGTCGAAGGTGGTGATCGGAATTCCCATCCTTTTATTGATGAG
TTCATTCCAACTGTTGATGAGGATGATGGAATCTGCTATACACATCCTCAAAATTTACCAGGTGTAAAGCAGGATGGAAGTGTCTCACAC
TTCTTTCACCGAGCAATTAAGGCTTATAATACAGGAACGCGTAAGCGTAGGAAAATACATGGTGATAATTCTGGTGATGTCCGCTGGCAT
AAGACTGGTCGCACAAAACCTGTTATCTTAGATGGAATCCAAAGAGGGTGTAAGAAGATTATGGTTCTTTATATAAGCCCATCTAAGGGT
GGGAAAGCCGAGAAGACAAATTGGGTGATGCACCAGTATCACCTAAGAACTGGTGAAGATGAAAGGGAAGGGGAATATGTTGTGTCTAAA
GTATTTTATCAGCAGCAGCAATCAAGCAGGGGTGAAAAA\
Edits in Original Sequence 
AGGAAAAGAAAATCAGCAAAGGGTTTTGATCACATCATTCTTCA(5')ATGGCTAGGCCATCATGGTTAGTTGACAGTAGGAGGATTGCA
ACAAAAATCAAGAGTGCATCAGGTGATCCTGCTACAGTGAATTGGAAGAGCAACCCTACAAAAGCTTGCCCTAATTGCCAGTTTATCATT
GACAATAATGACGTCAGCCATGACTGGCCAGGATTGCCAAGAGGTGTAAAATTTGATCCAACTGATCAAGAGATTATTTGGCACTTACTT
GGAAAAGTCGAAGGTGGTGATCGGAATTCCCATCCTTTTATTGATGAGTTCATTCCAACTGTTGATGAGGATGATGGAATCTGCTATACA
CATCCTCAAAATTTACCAGGTGTAAAGCAGGATGGAAGTGTCTCACACTTCTTTCACCGAGCAATTAAGGCTTATAATACAGGAACGCGT
AAGCGTAGGAAAATACATGGTGATAATTCTGGTGATGTCCGCTGGCATAAGACTGGTCGCACAAAACCTGTTATCTTAGATGGAATCCAA
AGAGGGTGTAAGAAGATTATGGTTCTTTATATAAGCCCATCTAAGGGTGGGAAAGCCGAGAAGACAAATTGGGTGATGCACCAGTATCAC
CTAAGAACTGGTGAAGATGAAAGGGAAGGGGAATATGTTGTGTCTAAAGTATTTTATCAGCAGCAGCAAgTCAAGCAGGGGTGAAAAA\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan