ESTScan Details for Unigene SGN-U252661

Score 
774
Direction 
Forward
Predicted Peptide Sequence 
VNQPSKFLCFSPCPQLWCRNWNWKSNKRSLTCFSSQKKIGFMDQILDYIEGGPKLRKWYGAPELLPKDGSLSEEDMSSEEDEVRDAVLVT
DGDNEIGQMIILSLIIKRTRIKALVKDKRVAMEAFGTYVEPIAGDARDRSLLKKALSGVRAVICPNEGFISNLESWKGLQHVILLSQLSV
YRGSSGIQAIVTANARKQAEQDESLVMASGIPHTIIRTGLLVNAPGGNQGFNFEEGCASQGKLSKEDAAFICVEALETVPQKGLIFEVVN
GEDKVMDWKEWFATLIDKSQV
Predicted Coding Sequence 
XXTGTGAATCAACCTTCAAAATTCTTGTGCTTCTCTCCATGTCCACAATTGTGGTGCAGAAATTGGAATTGGAAGAGTAATAAGCGTTCT
CTCACTTGCTTTTCTTCTCAGAAGAAAATAGGTTTTATGGACCAAATTCTAGATTACATTGAAGGCGGTCCAAAGTTAAGGAAATGGTAT
GGGGCACCTGAGCTCCTCCCAAAAGATGGATCCCTTTCAGAAGAAGACATGTCTTCGGAAGAAGATGAAGTCAGAGATGCAGTTTTAGTT
ACCGATGGAGATAATGAGATTGGTCAGATGATTATATTGTCTTTGATAATCAAAAGAACTCGGATCAAAGCTCTGGTAAAGGATAAGCGG
GTTGCAATGGAAGCATTTGGTACTTATGTTGAGCCAATAGCAGGTGATGCAAGGGACAGATCATTGCTAAAGAAGGCTCTAAGTGGTGTT
CGTGCAGTGATATGCCCAAATGAAGGTTTTATATCAAATTTAGAGAGTTGGAAAGGTTTACAACATGTAATCCTATTATCTCAGCTGTCT
GTTTATAGAGGTTCTAGTGGGATTCAAGCAATTGTTACTGCCAATGCAAGAAAACAGGCAGAACAAGATGAATCACTGGTTATGGCTTCG
GGAATCCCTCACACCATTATTAGAACTGGCTTGTTGGTAAATGCACCGGGTGGAAATCAAGGTTTCAACTTTGAAGAGGGCTGTGCATCA
CAAGGAAAGCTGAGCAAGGAGGATGCCGCTTTCATCTGTGTAGAGGCTCTTGAGACTGTGCCACAGAAAGGACTGATATTCGAGGTGGTC
AATGGTGAGGACAAGGTCATGGATTGGAAAGAGTGGTTTGCAACTTTGATAGATAAGTCACAAGTGTAA\
Edits in Original Sequence 
(5')XXTGTGAATCAACCTTCAAAATTCTTGTGCTTCTCTCCATGTCCACAATTGTGGTGCAGAAATTGGAATTGGAAGAGTAATAAGCG
TTCTCTCACTTGCTTTTCTTCTCAGAAGAAAATAGGTTTTATGGACCAAATTCTAGATTACATTGAAGGCGGTCCAAAGTTAAGGAAATG
GTATGGGGCACCTGAGCTCCTCCCAAAAGATGGATCCCTTTCAGAAGAAGACATGTCTTCGGAAGAAGATGAAGTCAGAGATGCAGTTTT
AGTTACCGATGGAGATAATGAGATTGGTCAGATGATTATATTGTCTTTGATAATCAAAAGAACTCGGATCAAAGCTCTGGTAAAGGATAA
GCGGGTTGCAATGGAAGCATTTGGTACTTATGTTGAGCCAATAGCAGGTGATGCAAGGGACAGATCATTGCTAAAGAAGGCTCTAAGTGG
TGTTCGTGCAGTGATATGCCCAAATGAAGGTTTTATATCAAATTTAGAGAGTTGGAAAGGTTTACAACATGTAATCCTATTATCTCAGCT
GTCTGTTTATAGAGGTTCTAGTGGGATTCAAGCAATTGTTACTGCCAATGCAAGAAAACAGGCAGAACAAGATGAATCACTGGTTATGGC
TTCGGGAATCCCTCACACCATTATTAGAACTGGCTTGTTGGTAAATGCACCGGGTGGAAATCAAGGTTTCAACTTTGAAGAGGGCTGTGC
ATCACAAGGAAAGCTGAGCAAGGAGGATGCCGCTTTCATCTGTGTAGAGGCTCTTGAGACTGTGCCACAGAAAGGACTGATATTCGAGGT
GGTCAATGGTGAGGACAAGGTCATGGATTGGAAAGAGTGGTTTGCAACTTTGATAGATAAGTCACAAGTGTAA\(3')TTTCTTTGGATC
CATAATTGGTGTATACATCAACAGTGTGAGAGAGGTTAACCATGATATAATTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan