ESTScan Details for Unigene SGN-U252746

Score 
815
Direction 
Forward
Predicted Peptide Sequence 
FEINHSAEXREFTRRKVKKRVRLMDADTVNNASTSTKGVNTNEVEAESNTVDSLEVLSSSGNVMQEVGSVGEILTRLELDLACVSEKLVN
LDLFVMHVETRESDFEAFASEKEGTSNDIVEKAIEFDVLSGVLDSEVTELGGLLSSVAIEIDNVRKVISSRGYVDEAFILIEEKLHDSEK
SLKQSQDHLLELRVQCTNFHGIMLTSQGDQNWEDSEAADYFNGDALLTPKTKIKMQTVEQQRHILRMLEKSLARELDLEKKLTESRQVEE
ELEVRLQQEALYMGEEIEDASQRLFEGENAAEVLLGISKSLLGQLQMAHFNLNGTVQKESYLQSKLQEMEEHLKAKDNLLGTSESTSKEL
G
Predicted Coding Sequence 
TTTGAGATTAATCACTCTGCAGAACXCCGCGAATTTACGAGAAGGAAGGTTAAAAAACGGGTTAGACTAATGGATGCTGACACAGTGAAT
AATGCATCTACTTCCACCAAAGGTGTTAACACCAATGAAGTGGAGGCAGAATCAAATACAGTAGACTCTCTAGAAGTTTTGTCTTCCAGT
GGTAATGTCATGCAAGAAGTAGGAAGTGTCGGGGAGATTTTAACAAGGCTTGAACTAGACTTGGCATGTGTCTCTGAGAAACTAGTTAAT
TTGGATTTATTTGTGATGCATGTGGAAACAAGAGAAAGTGACTTTGAGGCTTTTGCCTCTGAGAAGGAGGGCACTTCAAATGACATTGTT
GAGAAGGCAATAGAGTTTGATGTCTTATCTGGGGTCCTGGATTCAGAGGTGACGGAGCTAGGCGGTTTATTATCCTCTGTTGCAATAGAG
ATTGACAATGTGCGGAAGGTCATATCTTCACGTGGCTATGTGGATGAGGCTTTCATTTTAATAGAAGAGAAGTTACATGACAGTGAAAAA
TCCCTCAAGCAGTCGCAGGACCACCTTTTAGAATTGAGGGTGCAGTGTACCAACTTCCATGGGATTATGCTCACCTCCCAGGGGGACCAA
AATTGGGAAGATAGCGAGGCAGCAGACTATTTTAACGGTGATGCACTTTTAACTCCAAAGACGAAGATAAAAATGCAGACTGTTGAACAG
CAGAGACACATTCTGCGGATGCTGGAGAAGTCTTTGGCCAGAGAGTTAGATCTTGAGAAGAAGCTTACTGAATCTAGACAAGTTGAAGAA
GAATTAGAAGTCAGGTTGCAGCAAGAAGCTTTATACATGGGGGAAGAAATTGAAGATGCTTCGCAAAGGTTGTTTGAGGGAGAGAATGCT
GCTGAAGTCCTTTTAGGAATTTCAAAATCACTACTGGGTCAACTCCAGATGGCACATTTTAATCTGAACGGTACTGTTCAGAAAGAAAGC
TACTTACAGTCTAAACTTCAAGAAATGGAGGAACATTTAAAAGCAAAAGACAACTTACTAGGGACGTCTGAAAGCACTTCTAAAGAGCTC
GGG\
Edits in Original Sequence 
(5')TTTGAGATTAATCACTCTGCAGAACXCCGCGAATTTACGAGAAGGAAGGTTAAAAAACGGGTTAGACTAATGGATGCTGACACAGT
GAATAATGCATCTACTTCCACCAAAGGTGTTAACACCAATGAAGTGGAGGCAGAATCAAATACAGTAGACTCTCTAGAAGTTTTGTCTTC
CAGTGGTAATGTCATGCAAGAAGTAGGAAGTGTCGGGGAGATTTTAACAAGGCTTGAACTAGACTTGGCATGTGTCTCTGAGAAACTAGT
TAATTTGGATTTATTTGTGATGCATGTGGAAACAAGAGAAAGTGACTTTGAGGCTTTTGCCTCTGAGAAGGAGGGCACTTCAAATGACAT
TGTTGAGAAGGCAATAGAGTTTGATGTCTTATCTGGGGTCCTGGATTCAGAGGTGACGGAGCTAGGCGGTTTATTATCCTCTGTTGCAAT
AGAGATTGACAATGTGCGGAAGGTCATATCTTCACGTGGCTATGTGGATGAGGCTTTCATTTTAATAGAAGAGAAGTTACATGACAGTGA
AAAATCCCTCAAGCAGTCGCAGGACCACCTTTTAGAATTGAGGGTGCAGTGTACCAACTTCCATGGGATTATGCTCACCTCCCAGGGGGA
CCAAAATTGGGAAGATAGCGAGGCAGCAGACTATTTTAACGGTGATGCACTTTTAACTCCAAAGACGAAGATAAAAATGCAGACTGTTGA
ACAGCAGAGACACATTCTGCGGATGCTGGAGAAGTCTTTGGCCAGAGAGTTAGATCTTGAGAAGAAGCTTACTGAATCTAGACAAGTTGA
AGAAGAATTAGAAGTCAGGTTGCAGCAAGAAGCTTTATACATGGGGGAAGAAATTGAAGATGCTTCGCAAAGGTTGTTTGAGGGAGAGAA
TGCTGCTGAAGTCCTTTTAGGAATTTCAAAATCACTACTGGGTCAACTCCAGATGGCACATTTTAATCTGAACGGTACTGTTCAGAAAGA
AAGCTACTTACAGTCTAAACTTCAAGAAATGGAGGAACATTTAAAAGCAAAAGACAACTTACTAGGGACGTCTGAAAGCACTTCTAAAGA
GCTCGGG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan