ESTScan Details for Unigene SGN-U252832

Score 
-5
Direction 
Forward
Predicted Peptide Sequence 
DSSGSSHRPAAKVSRFIHQKPRAQKLLIMAALPYADVDSSLKALAGRAEGFGRFAIGGLNGPVYSVTSLADDGPGSLRDGCRKKEPLWIV
FEVSGTIHLTSYLRVSSHKTIDGRGQRIKLTGKGLQLKDCEHIIVCNLEFEGGRGHDVDGIQIKPNSRHIWIDRCSLRDYDDGLIDITRQ
STDITISRCYFAQHDKTMLIGADPSHVX
Predicted Coding Sequence 
GATTCTTCCGGTTCAAGTCACCGGCCGGCGGCTAAAGTTTCCCGGTTCATCCACCAAAAACCTAGAGCTCAGAAATTGCTGATCATGGCG
GCGTTGCCATATGCTGATGTCGATTCGAGCTTAAAAGCTCTAGCCGGTCGAGCCGAAGGGTTCGGCAGATTTGCGATCGGCGGTCTAAAT
GGTCCGGTCTATTCCGTCACATCATTGGCCGATGATGGTCCGGGATCACTCCGTGATGGATGCCGTAAGAAAGAACCACTATGGATTGTT
TTTGAAGTTTCAGGCACCATTCATCTCACGTCTTACCTACGCGTGTCATCCCATAAAACTATTGATGGTCGTGGCCAAAGGATAAAACTC
ACTGGCAAAGGCTTACAACTGAAGGATTGTGAGCACATAATCGTATGCAATTTGGAGTTTGAAGGTGGCAGAGGTCATGATGTTGACGGC
ATTCAAATAAAACCAAATTCTAGGCACATTTGGATAGACCGCTGTTCTCTTCGTGATTATGATGATGGGCTAATCGATATTACCAGACAA
AGCACAGATATAACTATTTCTAGATGTTATTTTGCTCAGCATGATAAGACAATGCTTATTGGAGCAGACCCGTCTCATGTTGXX\
Edits in Original Sequence 
AAATTTAGGATAAAGTTTACTATTGCCTTTTTTTTGTTTTTTTGTTTAAGATCTCCAATATAGAAGCTTTAACTAAACTCCAATATAAAT
ACAGTTGAATT
(5')GATTCTTCCGGTTCAAGTCACCGGCCGGCGGCTAAAGTTTCCCGGTTCATCCACCAAAAACCTAGAGCTCAGtAA
ATTGCTGATCATGGCGGCGTTGCCATATGCTGATGTCGATTCGAGCTTAAAAGCTCTAGCCGGTCGAGCCGAAGGGTTCGGCAGATTTGC
GATCGGCGGTCTAAATGGTCCGGTCTATTCCGTCACATCATTGGCCGATGATGGTCCGGGATCACTCCGTGATGGATGCCGTAAGAAAGA
ACCACTATGGATTGTTTTTGAAGTTTCAGGCACCATTCATCTCACGTCTTACCTACGCGTGTCATCCCATAAAACTATTGATGGTCGTGG
CCAAAGGATAAAACTCACTGGCAAAGGCTTACAACTGAAGGATTGTGAGCACATAATCGTATGCAATTTGGAGTTTGAAGGTGGCAGAGG
TCATGATGTTGACGGCATTCAAATAAAACCAAATTCTAGGCACATTTGGATAGACCGCTGTTCTCTTCGTGATTATGATGATGGGCTAAT
CGATATTACCAGACAAAGCACAGATATAACTATTTCTAGATGTTATTTTGCTCAGCATGATAAGACAATGCTTATTGGAGCAGACCCGTC
TCATGTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan