ESTScan Details for Unigene SGN-U252844

Score 
726
Direction 
Forward
Predicted Peptide Sequence 
AMGGMAAHIPIRDDPAANEAALELVRKDKLREVTAGHDGTWVTHPGLVPACMEVFTNNMGNSPNQIHSMKRQDSSILDEEXPAAEAERGL
YLGVPRLNTRVGIQYLAAWLTGLGCVPLYNFMEEAAAAEISRVQNWQWLKYGVELDGDGLGVKVNLDLFGRVVEDEMARIEREVGKEKFK
KGMYKVACKLFTGQCTAPVLDDFMTLDAYNSIVIHHPIGSSPALNFAAFRFLLFVVPVLFISIAIFPSNDEKKGNFAFEGIADYPKAL
Predicted Coding Sequence 
GCTATGGGAGGCATGGCAGCTCATATTCCAATTAGAGATGATCCAGCAGCTAATGAGGCAGCATTGGAACTTGTAAGGAAGGATAAGCTA
AGAGAAGTGACGGCGGGGCATGATGGGACATGGGTTACTCACCCTGGCCTAGTTCCAGCATGCATGGAAGTCTTCACTAACAACATGGGC
AATTCCCCAAACCAAATCCATTCCATGAAGCGTCAAGATTCATCCATTCTAGATGAAGAAGAXCCTGCTGCAGAGGCCGAGAGGGGTCTG
TACCTTGGAGTGCCTCGGCTGAACACCCGAGTGGGAATTCAGTACTTGGCAGCCTGGCTGACAGGGCTTGGTTGTGTCCCTCTTTACAAC
TTCATGGAGGAAGCTGCCGCAGCTGAGATTAGCAGAGTCCAGAATTGGCAGTGGCTGAAATATGGTGTGGAATTGGATGGGGATGGACTT
GGGGTGAAAGTGAACTTAGACCTGTTTGGAAGAGTGGTTGAGGATGAAATGGCTAGGATTGAGAGAGAAGTTGGAAAGGAGAAATTCAAG
AAGGGAATGTACAAGGTGGCTTGCAAGTTATTCACAGGGCAATGCACTGCACCAGTTTTGGATGATTTTATGACTCTTGATGCCTACAAT
AGCATTGTCATACATCATCCTATTGGATCATCXCCGGCTCTAAATTTTGCAGCTTTTCGTTTCCTATTATTTGTTGTCCCTGTATTGTTT
ATTAGTATTGCCATCTTCCCCAGTAATGATGAAAAGAAAGGGAATTTTGCCTTTGAGGGGATTGCTGATTATCCAAAGGCTCTCTAG\
Edits in Original Sequence 
(5')GCTATGGGAGGCATGGCAGCTCATATTCCAATTAGAGATGATCCAGCAGCTAATGAGGCAGCATTGGAACTTGTAAGGAAGGATAA
GCTAAGAGAAGTGACGGCGGGGCATGATGGGACATGGGTTACTCACCCTGGCCTAGTTCCAGCATGCATGGAAGTCTTCACTAACAACAT
GGGCAATTCCCCAAACCAAATCCATTCCATGAAGCGTCAAGATTCATCCATTCTAGATGAAGAAGAXCCTGCTGCAGAGGCCGAGAGGGG
TCTGTACCTTGGAGTGCCtTCGGCTGAACACCCGAGTGGGAATTCAGTACTTGGCAGCCTGGCTGACAGGGCTTGGTTGTGTCCCTCTTT
ACAACTTCATGGAGGAAGCTGCCGCAGCTGAGATTAGCAGAGTCCAGAATTGGCAGTGGCTGAAATATGGTGTGGAATTGGATGGGGATG
GACTTGGGGTGAAAGTGAACTTAGACCTGTTTGGAAGAGTGGTTGAGGATGAAATGGCTAGGATTGAGAGAGAAGTTGGAAAGGAGAAAT
TCAAGAAGGGAATGTACAAGGTGGCTTGCAAGTTATTCACAGGGCAATGCACTGCACCAGTTTTGGATGATTTTATGACTCTTGATGCCT
ACAATAGCATTGTCATACATCATCCTATTGGATCATCXCCGGCTCTAAATTTTGCAGCTTTTCGTTTCCTATTaATTTGTTGTCCCTGTA
TTGTTTATTAGTATTGCCATCTTCCCCAGTAATGATGAAAAGAAAGGGAATTTTGCCTTTGAGGGGATTGCTGATTATCCAAAGGCTCTC
TAG\(3')TTCAGCTTTGGTTTTCAATTTATCTGTTATTTGTATCTATCCATTGTAATAAAGGAAATTGTTCATTTTTAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan