ESTScan Details for Unigene SGN-U253052

Score 
680
Direction 
Forward
Predicted Peptide Sequence 
AGCPRIIHRDIKSPNILLDNNFDARVADFGLAKLAQDAKSHVTTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKSVDASQ
PLGEESLVEWARPLLGNALEKEEFNQLTDPRLGNNYIDSEMFRMIEIAAACVRHSAAKRPGMGQIMRAFDSMLMSDLTNGMKVGESAIYN
SAEQSAQIRLFRRMAFPSQDVNSDFSSQSTNYSRELSEHXLDETSVNISKAALAERYID
Predicted Coding Sequence 
XXGGCAGGCTGTCCTCGCATCATTCACAGAGATATTAAGTCACCTAACATTCTTTTGGATAACAACTTTGATGCTCGGGTTGCTGATTTT
GGATTAGCTAAATTAGCTCAGGATGCAAAAAGCCATGTTACAACACGTGTAATGGGTACCTTTGGATACATGGCCCCTGAATATGCATCC
AGTGGAAAGCTGACTGAAAAATCCGATGTATTTTCCTTTGGAGTTGTGCTTCTGGAGCTAATTACTGGACGGAAGTCTGTGGATGCATCT
CAGCCTTTGGGGGAGGAAAGTCTAGTTGAGTGGGCTCGACCTTTGCTTGGTAATGCACTTGAAAAAGAGGAATTTAATCAGTTGACAGAT
CCTCGCCTTGGGAATAATTACATTGACAGTGAGATGTTTCGAATGATTGAGATTGCTGCAGCTTGTGTGCGTCACTCAGCTGCAAAGAGA
CCAGGGATGGGACAGATCATGAGAGCTTTTGATAGTATGCTAATGTCTGATTTGACAAACGGGATGAAAGTTGGTGAAAGTGCAATATAT
AACTCTGCTGAGCAATCTGCACAGATAAGATTGTTTCGAAGGATGGCATTTCCTAGTCAAGATGTTAATTCAGATTTTTCAAGTCAAAGC
ACCAATTATAGTAGAGAGTTGTCTGAACATGXTTTAGATGAAACATCTGTTAATATATCAAAGGCTGCTTTAGCTGAGAGGTACATTGAT
TAA\
Edits in Original Sequence 
(5')XXGGCAGGCTGTCCTCGCATCATTCACAGAGATATTAAGTCACCTAACATTCTTTTGGATAACAACTTTGATGCTCGGGTTGCTGA
TTTTGGATTAGCTAAATTAGCTCAGGATGCAAAAAGCCATGTTACAACACGTGTAATGGGTACCTTTGGATACATGGCCCCTGAATATGC
ATCCAGTGGAAAGCTGACTGAAAAATCCGATGTATTTTCCTTTGGAGTTGTGCTTCTGGAGCTAATTACTGGACGGAAGTCTGTGGATGC
ATCTCAGCCTTTGGGGGAGGAAAGTCTAGTTGAGTGGGCTCGACCTTTGCTTGGTAATGCACTTGAAAAAGAGGAATTTAATCAGTTGAC
AGATCCTCGCCTTGGGAATAATTACATTGACAGTGAGATGTTTCGAATGATTGAGATTGCTGCAGCTTGTGTGCGTCACTCAGCTGCAAA
GAGACCAGGGATGGGACAGATCATGAGAGCTTTTGATAGTATGCTAATGTCTGATTTGACAAACGGGATGAAAGTTGGTGAAAGTGCAAT
ATATAACTCTGCTGAGCAATCTGCACAGATAAGATTGTTTCGAAGGATGGCATTTCCTAGTCAAGATGTTAATTCAGATTTTTCAAGTCA
AAGCACCAATTATAGTAGAGAGTTGTCTGAACATGXTTTAGATGAAACATCTGTTAATATATCAAAGGCTGCTTTAGCTGAGAGGTACAT
TGATTAA\(3')GTTTTGTAAAGTAGGTCTCTTTTTAGCTTGACATACAACATGTAGTCTCTGCAATTTGACAGCATTTTTTTCTGTAAG
TAACTGGTACACAACTGATCAAGAGTTCATTCATTTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan