ESTScan Details for Unigene SGN-U253079

Score 
316
Direction 
Forward
Predicted Peptide Sequence 
KIRNTSXESDEILRRRISSKCRNSQMGSENLSLIDSRKRANFRLCNVSGYKMDLLEIHAKDPKFHVLFIPGNPGVISFYLDFLESLYVLL
DGTASXDSNLAHCPNRKELGARKVVLTARTNRSQDKLHRAELQDVEVPIVLVGHSIGSYISLDIFKRFQGKVAYCICLYPFLAVNTKSST
QSVIKKIAASRTLSTGLSSIVAILGLLPVWISRILVKNSVGKSWCPAAVEALCSHVLRYHTVQNMLYMAMTEFEKLSEVPDWSFMREKKS
QMAFLFGVDDHWGPLDLYEXEAGFLWVAKHVSGXNQEYFSKIDAERRYFFLETLXAVNKIELICDRSFLVHKNSESYFKRIFDLDGNYIV
SELRIX
Predicted Coding Sequence 
AAAATTAGAAACACTTCAGXTGAGTCGGACGAAATCCTCAGGAGAAGAATTTCATCAAAGTGCAGAAATTCACAAATGGGTTCAGAAAAT
TTGAGTCTAATTGATTCAAGAAAGCGTGCAAATTTTCGGCTTTGTAACGTTTCAGGTTATAAGATGGATCTGCTGGAAATTCATGCCAAG
GACCCGAAGTTTCATGTCTTGTTTATTCCTGGAAATCCAGGTGTTATCTCGTTTTATCTTGATTTTCTGGAATCACTCTATGTTCTGCTG
GATGGAACTGCATCTGXTGACAGCAATCTCGCACATTGCCCAAACAGAAAAGAATTGGGAGCGCGGAAGGTTGTTCTCACTGCAAGAACA
AACAGATCACAAGATAAACTTCATAGAGCTGAGCTTCAGGATGTCGAAGTTCCTATAGTACTGGTTGGTCATTCTATTGGATCATACATA
TCTCTAGACATTTTTAAAAGATTTCAAGGAAAGGTGGCATACTGCATTTGCTTGTATCCATTTCTAGCTGTAAACACCAAGTCTTCAACA
CAATCTGTTATTAAGAAGATTGCAGCATCTCGCACCTTATCTACAGGCCTTAGTTCAATTGTAGCAATTCTGGGATTGTTACCAGTCTGG
ATCTCCAGGATTCTGGTGAAAAACTCTGTGGGAAAGTCCTGGTGCCCAGCTGCAGTGGAAGCTCTCTGTTCACATGTCCTCAGGTACCAT
ACCGTTCAGAACATGCTATACATGGCAATGACCGAATTCGAAAAGCTTTCTGAGGTACCTGATTGGTCATTTATGAGGGAAAAGAAAAGT
CAGATGGCATTTTTATTTGGAGTCGACGATCACTGGGGTCCCTTAGATCTCTATGAAGAXGAGGCTGGTTTTTTATGGGTAGCTAAGCAT
GTTTCTGGCTTXAATCAAGAATATTTTTCAAAAATAGACGCCGAGAGACGTTATTTCTTTCTGGAAACGCTTCANGCAGTCAATAAAATC
GAGCTAATATGTGATCGATCGTTTCTGGTTCACAAAAATTCAGAATCATATTTCAAGAGAATATTCGATTTGGATGGAAATTATATTGTA
TCAGAGCTACGTATTAAX\
Edits in Original Sequence 
(5')AAAATTAGAAACACTTCAGXTGAGTCGGACGAAATCCTCAGGAGAAGAATTTCATCAAAGTGCAGAAATTCACAAATGGGTTCAGA
AAATTTGAGTCTAATTGATTCAAGAAAGCGTGCAAATTTTCGGCTTTGTAACGTTTCAGGTTATAAGATGGATCTGCTGGAAATTCATGC
CAAGGACCCGAAGTTTCATGTCTTGTTTATTCCTGGAAATCCAGGTGTTATCTCGTTTTATCTTGATTTTCTGGAATCACTCTATGTTCT
GCTGGATGGAACTGCATCTGXTGACAGCAATCTCGCACATTGCCCAAACAGAAAAGAATTGGGAGCGCGGAAGGTTGTTCTCACTGCAAG
AACAAACAGATCACAAGATAAACTTCATAGAGCaTGAGCTTCAGGATGTCGAAGTTCCTATAGTACTGGTTGGTCATTCTATTGGATCAT
ACATATCTCTAGACATTTTTAAAAGATTTCAAGGAAAGGTGGCATACTGCATTTGCTTGTATCCATTTCTAGCTGTAAACACCAAGTCTT
CAACACAATCTGTTATTAAGAAGATTGCAGCATCTCGCACCTTATCTACAGGCCTTAGTTCAATTGTAGCAATTCTGGGATTGTTACCAG
TCTGGATCTCCAGGATTCTGGTGAAAAACTCTGTGGGAAAGTCCTGGTGCCCAGCTGCAGTGGAAGCTCTCTGTTCACATGTCCTCAGGT
ACCATACCGTTCAGAACATGCTATACATGGCAATGACCGAATTCGAAAAGCTTTCTGAGGTACCTGATTGGTCATTTATGAGGGAAAAGA
AAAGTCAGATGGCATTTTTATTTGGAGTCGACGATCACTGGGGTCCCTTAGATCTCTATGAAGAXGAGGCTGGTTTTTTATGGGTAGCTA
AGCATGTTTCTGGCTTXAATCAAGAATATTTTTCAAAAATAGACGCCGAGtAGACGTTATTTCTTTCTGGAAACGCTTCANGCAGTCAAT
AAAATCGAGCTAATATGTGATCGATCGTTTCTGGTTCACAAAAATTCAGAATCATATTTCAAGAGAATATTCGATTTGGATGGAAATTAT
ATTGTATCAGAGCTACGTATTAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan