ESTScan Details for Unigene SGN-U253662

Score 
635
Direction 
Forward
Predicted Peptide Sequence 
PLSAIKSMKDMVKKLHANGIEVFLEVVFTHTAEDAPLMNVDNFSYCIKGGQYLNIQNAXELQLPHSPTNDFGLLRHWVIEFHIDGFVFVN
XFLKEENIQWHGSDQSPPKWDGPSSKFLAMTLKADAEVSQTLVSDIVGDLFVAFNGAGDSEIVILPPPPTDMVWHRLVDTALPFPGFFDE
KGTPVEDELVAYEMKSHSCLLFEAQRLAEIDSSKRKKQIRLSSKRQ
Predicted Coding Sequence 
XACCCTCTTTCTGCCATTAAATCGATGAAGGATATGGTTAAGAAATTACATGCTAATGGGATAGAGGTTTTTCTTGAAGTTGTTTTCACT
CACACTGCAGAGGATGCACCTTTGATGAATGTTGATAACTTTTCATATTGCATAAAAGGTGGTCAGTATCTGAATATTCAAAATGCAXTT
GAATTGCAATTACCCCATAGTCCAACAAATGATTTTGGACTTCTCCGCCACTGGGTAATTGAGTTTCATATTGATGGTTTTGTTTTTGTC
AACGXCTTCTTGAAGGAAGAAAACATCCAGTGGCATGGGAGTGACCAATCTCCTCCGAAATGGGATGGCCCGTCTAGCAAATTCTTGGCT
ATGACTTTGAAGGCCGATGCTGAAGTCAGCCAGACATTAGTCTCTGATATCGTAGGTGACCTGTTTGTTGCTTTCAATGGTGCTGGTGAT
TCAGAGATTGTTATCCTTCCACCACCTCCAACAGATATGGTATGGCATCGTCTCGTTGACACAGCCCTCCCTTTCCCGGGGTTTTTCGAT
GAGAAGGGAACTCCAGTTGAAGATGAATTAGTTGCATATGAGATGAAGTCTCACAGCTGTTTGCTGTTTGAAGCTCAGAGACTAGCTGAA
ATAGATTCTAGCAAGAGAAAGAAACAGATTAGACTTTCTTCTAAGAGGCAATAG\
Edits in Original Sequence 
(5')XACCCTCTTTCTGCCATTAAATCGATGAAGGATATGGTTAAGAAATTACATGCTAATGGGATAGAGGTTTTTCTTGAAGTTGTTTT
CACTCACACTGCAGAGGATGCACCTTTGATGAATGTTGATAACTTTTCATATTGCATAAAAGGTGGTCAGTATCTGAATATTCAAAATGC
AXTTGAATTGCAATTACCCCATAGTCCAACAAATGATTTTGGACTgTCTCCGCCACTGGGTAATTGAGTTTCATATTGATGGTTTTGTTT
TTGTCAACGXCTTCTTGAAGGAAGAAAACATCCAGTGGCATGGGAGTGACCAATCTCCTCCGAAATGGGATGGCCCGTCTAGCAAATTCT
TGGCTATGACTTTGAAGGCCGATGCTGAAGTCAGCCAGACATTAGTCTCTGATATCGTAGGTGACCTGTTTGTTGCTTTCAATGGTGCTG
GTGATTCAGAGATTGTTATCCTTCCACCACCTCCAACAGATATGGTATGGCATCGTCTCGTTGACACAGCCCTCCCTTTCCCGGGGTTTT
TCGATGAGAAGGGAACTCCAGTTGAAGATGAATTAGTTGCATATGAGATGAAGTCTCACAGCTGTTTGCTGTTTGAAGCTCAGAGACTAG
CTGAAATAGATTCTAGCAAGAGAAAGAAACAGATTAGACTTTCTTCTAAGAGGCAATAG\(3')TTTGTAAAGCCCCTAAGTATATATAT
ATATGTTTAAATAAGAGGCTTTTTTTTTCTGAATAAATAAGAATATTTTACTGAGAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan