ESTScan Details for Unigene SGN-U253932

Score 
268
Direction 
Forward
Predicted Peptide Sequence 
MVFPVRRVWGAVSARVKPRKDGAGLLKLQGDIQSCGYEDVQVMWEMLGGTESELTSRHIKRKTPTVVWNFVTVQHHPPLQITPLRRYAAL
QK
Predicted Coding Sequence 
ATGGTCTTTCCGGTTAGACGTGTTTGGGGTGCTGTTTCTGCTCGTGTCAAGCCTCGTAAAGATGGTGCTGGATTATTGAAGCTTCAAGGC
GATATACAGTCCTGTGGATATGAAGATGTACAGGTGATGTGGGAAATGCTTGGAGGGACGGAGTCAGAGTTGACATCTCGGCACATTAAG
CGTAAAACGCCAACAGTTGTTTGGAATTTTGTXACGGTTCAACACCATCCTCCTCTACAGATCACACCATTGAGACGGTATGCTGCACTG
CAGAAATAA\
Edits in Original Sequence 
GACTCAAGAGTGGAAGGAACACATCACTCCTTTATTAGTCTCTAGTCATTACATTCTTTATTGCAACAAAGAGCACTATAAACCCTTTCA
TTTTCAACCAAACATAGGAGTAGAGGAGAGGAGATGGAGGATTTGTGGCAAAAA
(5')ATGGTCTTTCCGGTTAGACGTGTTTGGGGTGC
TGTTTCTGCTCGTGTCAAGCCTCGTAAAGATGGTGCTGGATTATTGAAGCTTCAAGGCGATATACAGTCCTGTGGATATGAAGATGTACA
GGTGATGTGGGAAATGCTTGGAGGGACGGAGTCAGAGTTGACATCTCGGCACATTAAGCGTAAAACGCCAACAGTTGTTTaGGAATTTTG
TXACGGTTCAACACCATCCTCCTCTACAGATCACACCATTGAGACGGTATGCTGCACTGCAGAAATAA\(3')GAGTATCTGAAGAGTGA
AGAGATGTATGTTACTTATATTTCTCAAGCCCCTGGGTAGATATGGGGACTTTCATGGCAACATTATCAGTTGTAAATATACCATCGCCC
TGATGATGTATGAAAATTCGGCACTAAATAAAGAAAAAGAACTATGAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan