ESTScan Details for Unigene SGN-U254495

Score 
650
Direction 
Forward
Predicted Peptide Sequence 
MSKSILVTGGAGYIGSHTVLQLLLGGYKAVVIDNLDNSSEIAVKRVKEIAGEYGSNLSFHKVDLRDKPAVEEIFRSNKFDAVIHFAGLKA
VGESVEKPLMYYDNNLIGTITLLEIMAAHGCKKLVFSSSATVYGWPKVVPCTEEFPLSAANPYGRTKLFIEEICRDVQNADSEWKIILLR
YFNP
Predicted Coding Sequence 
ATGTCGAAGAGTATACTTGTGACAGGGGGAGCAGGGTATATTGGGAGTCACACAGTGTTGCAATTGTTGCTTGGTGGTTATAAGGCTGTG
GTGATTGATAATTTGGATAATTCTTCTGAAATTGCTGTGAAAAGGGTCAAGGAAATTGCTGGTGAATATGGTTCTAATCTCTCTTTTCAT
AAGGTGGATCTACGTGATAAGCCGGCAGTTGAGGAGATTTTCAGGTCTAACAAATTTGATGCTGTTATCCATTTTGCTGGACTAAAAGCA
GTTGGTGAAAGTGTTGAAAAACCTCTGATGTACTATGACAACAACCTTATTGGAACAATTACCCTCTTGGAAATCATGGCAGCTCATGGA
TGCAAAAAGCTTGTGTTTTCATCGTCAGCTACTGTTTATGGTTGGCCAAAAGTGGTTCCTTGTACTGAGGAATTCCCCCTGAGTGCTGCA
AATCCTTATGGACGGACAAAGCTCTTCATTGAAGAAATATGCCGTGATGTACAAAACGCGGACTCTGAATGGAAAATCATATTGCTGCGG
TACTTTAATCCT\
Edits in Original Sequence 
AAAAGATCAGATTTTTTTCTTGATTTTTGGAATTCTTTTTTACCAAAACTCAAATCTTGTTATATAAAATTCAGGGTTAGTTTTTTTAAT
TGTTTTATAGTACAAT
(5')ATGTCGAAGAGTATACTTGTGACAGGGGGAGCAGGGTATATTGGGAGTCACACAGTGTTGCAATTGTTGC
TTGGTGGTTATAAGGCTGTGGTGATTGATAATTTGGATAATTCTTCTGAAATTGCTGTGAAAAGGGTCAAGGAAATTGCTGGTGAATATG
GTTCTAATCTCTCTTTTCATAAGGTGGATCTACGTGATAAGCCGGCAGTTGAGGAGATTTTCAGGTCTAACAAATTTGATGCTGTTATCC
ATTTTGCTGGACTAAAAGCAGTTGGTGAAAGTGTTGAAAAACCTCTGATGTACTATGACAACAACCTTATTGGAACAATTACCCTCTTGG
AAATCATGGCAGCTCATGGATGCAAAAAGCTTGTGTTTTCATCGTCAGCTACTGTTTATGGTTGGCCAAAAGTGGTTCCTTGTACTGAGG
AATTCCCCCTGAGTGCTGCAAATCCTTATGGACGGACAAAGCTCTTCATTGAAGAAATATGCCGTGATGTACAAAACGCGGACTCTGAAT
GGAAAATCATATTGCTGCGGTACTTTAATCCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan