ESTScan Details for Unigene SGN-U254717

Score 
140
Direction 
Forward
Predicted Peptide Sequence 
VPLPPVPFVFLGDIQSSAAKRDMSGTSGLLQLWQVPSSSLFFGRSKLSKGLYLVPVRVMYPMSCFCKQMQTTTYAIVKGSYVSNPQNQQE
NKEKLTPKVENVGAFQKLPMVMPSVDILHSALRKARRVSPTKGIANAAKRERNKGAKQLDALMKELAVPLRTYKENFPNKKYLHPYERSL
IELTL
Predicted Coding Sequence 
GTCCCACTACCGCCAGTCCCTTTTGTTTTTCTTGGGGATATTCAGAGCTCAGCXGCTAAGAGAGATATGAGCGGTACTTCAGGTCTTCTT
CAGCTATGGCAAGTTCCGTCCTCATCACTGTTTTTCGGCCGTTCCAAGCTTTCCAAAGGTCTGTACTTGGTTCCTGTGCGTGTTATGTAT
CCAATGTCATGTTTCTGTAAGCAAATGCAAACTACTACGTATGCAATTGTTAAAGGAAGCTATGTATCAAATCCACAGAATCAACAAGAA
AACAAAGAAAAATTGACACCTAAGGTAGAAAATGTAGGTGCATTTCAAAAATTACCCATGGTAATGCCGTCTGTAGATATTCTACATTCA
GCACTGAGGAAAGCAAGGAGGGTCTCGCCTACAAAGGGCATTGCTAATGCTGCAAAACGTGAGAGAAATAAAGGCGCAAAACAACTTGAC
GCATTAATGAAGGAGTTGGCTGTGCCCTTGAGGACATACAAAGAGAACTTCCCAAACAAAAAATATTTGCACCCTTATGAACGATCTTTG
ATTGAGTTAACGCTC\
Edits in Original Sequence 
(5')GTCCCACTACCGCCAGTCCCTTTTGTTTTTCTTGGGGATATTCAGAGCTCAGCXGCTAAGAGAGATATGAGCGGTACTTCAGGTCT
TCTTCAGCTATGGCAAGTTCCGTCCTCATCACTGTTTTTCGGCCGTTCCAAGCTTTCCAAAGGTCTGTACTTGGTTCCTGTGCGTGTTAT
GTATCCAATGTCATGTTTCTGTAAGCAAATGCAAACTACTACGTATGCAATTGTTAAAGGAAGCTATGTATCAAATCCACAGAATCAACA
AGAAAACAAAGAAAAATTGACACCTAAGGTAGAAAATGTAGGTGCATTTCAAAAATTACCCATGGTAATGCCGTCTGTAGATATTCTACA
TTCAGCACTGAGGAAAGCAAGGAGGGTCTCGCCTACAAAGGGCATTGCTAATGCTGCAAAACGTGAGAGAAATAAAGGCGCAAAACAACT
TGACGCATTAATGAAGGAGTTGGCTGTGCCCTTGAGGACATACAAAGAGAACTTCCCAAACAAAAAATATTTGCACCCTTATGAACGATC
TTTGATTGAGTTAACGCTC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan