ESTScan Details for Unigene SGN-U254723

Score 
507
Direction 
Forward
Predicted Peptide Sequence 
PGLNVYGAMLGACKIHKNVDLGEKAADKLFELDPDDGGYHVLLANMYATASIWHKVANVRTMMERKGIQKTPGWSLVDLRNEVHTFYSGS
TSHPQSEKIYAYLEKLFDRIKAAGYIPDTDSIHDVEDVVQEQLLKSHSEKLAIAFGLLNTSAGTTVHIRKNLRVCGDCHSATKYISLVMK
REIIVRDMHRFHHFKDGAVHVEITGDLND
Predicted Coding Sequence 
CCAGGACTCAATGTCTATGGTGCAATGTTGGGAGCTTGCAAGATTCACAAAAATGTTGATTTGGGGGAGAAGGCAGCAGACAAGCTATTT
GAGCTAGATCCCGATGATGGTGGATATCATGTGCTTCTTGCTAATATGTACGCCACGGCTTCAATATGGCATAAAGTTGCTAACGTCAGA
ACTATGATGGAGAGAAAAGGTATTCAAAAGACACCTGGATGGAGTCTAGTTGATTTAAGAAACGAGGTCCACACATTCTACTCAGGAAGC
ACTAGCCATCCTCAGTCAGAGAAGATCTATGCTTACCTTGAGAAACTGTTTGATAGGATTAAAGCTGCTGGATATATACCTGATACTGAT
TCAATTCACGATGTGGAAGATGTTGTTCAGGAGCAATTGCTAAAGAGCCACAGTGAGAAGCTTGCTATTGCATTTGGGCTTTTAAATACA
AGTGCTGGTACAACTGTTCACATCAGGAAAAATCTCCGGGTTTGTGGTGACTGCCATAGTGCAACAAAGTACATCTCGCTTGTCATGAAA
CGAGAAATTATTGTACGTGATATGCACCGTTTCCACCATTTTAAGGATGGAGCTGTTCATGTGGAGATTACTGGTGATCTGAATGATTGA
\
Edits in Original Sequence 
(5')CCAGGACTCAATGTCTATGGTGCAATGTTGGGAGCTTGCAAGATTCACAAAAATGTTGATTTGGGGGAGAAGGCAGCAGACAAGCT
ATTTGAGCTAGATCCCGATGATGGTGGATATCATGTGCTTCTTGCTAATATGTACGCCACGGCTTCAATATGGCATAAAGTTGCTAACGT
CAGAACTATGATGGAGAGAAAAGGTATTCAAAAGACACCTGGATGGAGTCTAGTTGATTTAAGAAACGAGGTCCACACATTCTACTCAGG
AAGCACTAGCCATCCTCAGTCAGAGAAGATCTATGCTTACCTTGAGAAACTGTTTGATAGGATTAAAGCTGCTGGATATATACCTGATAC
TGATTCAATTCACGATGTGGAAGATGTTGTTCAGGAGCAATTGCTAAAGAGCCACAGTGAGAAGCTTGCTATTGCATTTGGGCTTTTAAA
TACAAGTGCTGGTACAACTGTTCACATCAGGAAAAATCTCCGGGTTTGTGGTGACTGCCATAGTGCAACAAAGTACATCTCGCTTGTCAT
GAAACGAGAAATTATTGTACGTGATATGCACCGTTTCCACCATTTTAAGGATGGAGtCTGTTCATGTGGAGATTACTGGTGATCTGAATG
ATTGA\(3')TAACTCTACCAAGTTGTTAGCTCATGTTAATTATGTAAAACATTTTATTATTCTGATATAGAATAACCACACCACATGGG
TATCTGGAACAAAGGTGGGAAAGTGACGACTGATGTGGAACTGATTTCTCTAACTGGTTAAAATCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan