ESTScan Details for Unigene SGN-U254803

Score 
452
Direction 
Forward
Predicted Peptide Sequence 
IKPGYEDLLEEIESDIDASLKEFVGCPTFXHLQPDVRIASSKAYQEGKMYGIDAASGAAVTALDISVGDHVLDLCAAPGAKLCMMLDILG
SSGSVTGVDIAKHRLAACRTMLQKYSLGDHCRLFVADGTSFSLLPVRVHSGSPLQNENADEFASGEKSEDIGSGSPXRPWKERKKEAIAR
EKGVXKLFSPTQEPELIFYGRYSGGVWDEKNEX
Predicted Coding Sequence 
XXGATAAAGCCCGGTTATGAGGATTTGCTTGAAGAAATTGAAAGTGATATTGATGCAAGCTTGAAAGAGTTTGTTGGTTGCCCAACTTTT
XATCATCTTCAACCTGATGTTCGAATTGCTAGTTCGAAGGCATACCAAGAAGGGAAGATGTATGGAATTGATGCAGCATCCGGAGCTGCT
GTGACAGCTTTAGACATTTCAGTTGGGGATCATGTCCTTGATCTTTGCGCTGCACCTGGTGCTAAACTTTGTATGATGTTGGACATTCTT
GGAAGTTCGGGTTCTGTGACTGGTGTTGACATTGCAAAACATCGATTAGCGGCCTGTAGAACCATGCTACAGAAATATAGTCTTGGTGAT
CATTGTCGTCTTTTTGTTGCTGATGGAACCAGCTTTTCCCTTCTCCCTGTCAGGGTTCATTCAGGCTCTCCGTTGCAAAATGAAAATGCG
GATGAATTTGCTTCCGGAGAAAAATCTGAAGATATCGGGAGTGGAAGTCCCGXCAGACCATGGAAAGAAAGGAAGAAGGAAGCTATAGCT
AGAGAAAAAGGTGTCTNCAAGCTATTCTCACCAACTCAAGAACCAGAGCTTATATTTTATGGTCGGTATTCTGGGGGTGTTTGGGATGAG
AAAAATGAATXX\
Edits in Original Sequence 
(5')XXGATAAAGCCCGGTTATGAGGATTTGCTTGAAGAAATTGAAAGTGATATTaGATGCAAGCTTGAAAGAGTTTGTTGGTTGCCCAA
CTTTTXATCATCTTCAACCTGATGTTCGAATTGCTAGTTCGAAGGCATACCAAGAAGGGAAGATGTATGGAATTGATGCAGCATCCGGAG
CTGCTGTGACAGCTTTAGACATTTCAGTTGGGGATCATGTCCTTGATCTTTGCGCTGCACCTGGTGCTAAACTTTGTATGATGTTGGACA
TTCTTGGAAGTTCGGGTTCTGTGACTGGTGTTGACATTGCAAAACATCGATTAGCGGCCTGTAGAACCATGCTACAGAAATATAGTCTTG
GTGATCATTGTCGTCTTTTTGTTGCTGATGGAACCAGCTTTTCCCTTCTCCCTGTCAGGGTTCATTCAGGCTCTCCGTTGCAAAATGAAA
ATGCGGATGAATTTGCTTCCGGAGAAAAATCTGAAGtATATCGGGAGTGGAAGTCCCGXCAGACCATGGAAAGAAAGGAAGAAGGAAGCT
ATAGCTAGAGAAAAAGGTGTCTNCAAGCTATTCTCACCAACTCAAGAACCAGAGCTTATATTTTATGGTCGGTATTCTGGGGGTGTTTGG
GATGAGaAAAAATGAATXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan