ESTScan Details for Unigene SGN-U255189

Score 
389
Direction 
Forward
Predicted Peptide Sequence 
DDFSTDYESSVPVDEPEKVEKVEKVQLAKHSADAASTSTSSVVTKQIEPPAKPVVREDASSIIEMKRILDSADHYEALGVSRHKKIDTLL
LKKEYRKKAMLVHPDKNMGSPLASESFKKLQCGYEVLSDAVKKRDYDEQLRKEESKSVMQKSPSTPTRNPPTTAQKSRGVSTAQNVATHT
FGSAPIGXKVKARWCQDCCQYHQAKDGDGWVEYKGSLVFNRPXKAEIPRAFVCAX
Predicted Coding Sequence 
GATGACTTCTCCACAGATTATGAGTCATCAGTTCCTGTGGATGAACCTGAAAAGGTTGAAAAGGTTGAAAAGGTTCAGCTTGCAAAACAT
TCTGCXGACGCTGCATCTACTTCTACTTCATCAGTTGTAACCAAACAGATAGAACCCCCAGCTAAGCCAGTAGTTAGAGAAGATGCAAGT
TCAATAATTGAGATGAAGCGGATATTAGATAGTGCGGATCATTATGAAGCACTAGGGGTTTCTCGGCATAAGAAAATTGACACTTTACTG
TTGAAAAAAGAATATCGTAAAAAGGCAATGCTTGTGCACCCGGACAAAAACATGGGAAGTCCACTTGCCAGTGAATCATTTAAGAAACTT
CAATGTGGATATGAGGTTCTTTCTGATGCTGTCAAGAAGCGAGACTATGATGAGCAACTCAGAAAGGAAGAATCTAAGAGTGTAATGCAA
AAATCACCTAGCACTCCAACCAGGAATCCTCCAACTACTGCTCAGAAGAGTCGAGGCGTATCCACTGCACAAAATGTGGCAACTCACACA
TTTGGATCTGCACCAATAGGAXCAAAGGTCAAGGCAAGATGGTGCCAGGATTGTTGTCAATATCACCAAGCCAAAGATGGGGATGGATGG
GTAGAGTACAAAGGATCATTGGTTTTTAATAGACCACANAAGGCGGAGATACCTCGTGCTTTCGTTTGTGCTGXX\
Edits in Original Sequence 
(5')GATGACTTCTCCACAGATTATGAGTCATCAGTTCCTGTGGATGAACCTGAAAAGGTTGAAAAGGTTGAAAAGGTTCAcGCTTGCAA
AACATTCTGCXGACGCTGCATCTACTTCTACTTCATCAGTTGTAACCAAACAGATAGAACCCCCAGCTAAGCCAGTAGTTAGAGAAGATG
CAAGTTCAATAATTGAGATGAAGCGGATATTAGATAGTGCGGATCATTATGAAGCACTAGGGGTTTCTCGGCATAAGAAAATTGACACTT
TACTGTTGAAAAAAGAATATCGTAAAAAGGCAATGCTTGTGCACCCGGACAAAAACATGGGAAGTCCACTTGCCAGTGAATCATTTAAGA
AACTTCAATGTGGATATGAGGTTCTTTCTGATGCTGTCAAGAAGCGAGACTATGATGAGCAACTCAGAAAGGAAGAATCTAAGAGTGTAA
TGCAAAAATCACCTAGCACgTCCAACCAGGAATCCTCCAACTACTGCTCAGAAGAGTCGAGGCGTATCCACTGCACAAAATGTGGCAACT
CACACATTTGGATCTGCACCAATAGGAXCAAAGGTCAAGGCAAGATGGTGCCAGGATTGTTGTCAATATCACCAAGCCAAAGATGGGGAT
GGATGGGTAGAGTACAAAGGATCATTGGTTTTTAATAGACCACANAAGGCGGAGATACCTCGTGCTTTCGTTTGTGCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan