ESTScan Details for Unigene SGN-U255207

Score 
325
Direction 
Reverse
Predicted Peptide Sequence 
QEEAGKAASKNNARQCLSPLSXQYPRFTGSNFLDLNKLFXYVIHPLNSLLVNNLXRSNNRTFXNTTFKPFPASRRPQIVDXEAPETCGVL
SNFNGPGVKDEQQRVYKNKQMDNGFCRTKPSSNCFLSSITHFKNAPIPP
Predicted Coding Sequence 
XTGCAGGAAGAAGCTGGTAAAGCAGCATCAAAGAATAATGCAAGACAATGTCTGTCTCCTCTCAGTGNTCAGTATCCCCGTTTCACTGGA
TCAAACTTCCTTGATCTCAACAAGCTCTTTNCCTATGTTATCCATCCATTGAACTCTCTTCTTGTCAATAATCTCNTTAGGTCCAACAAC
AGGACTTTTCNTAATACAACTTTTAAGCCATTTCCAGCATCTAGACGACCTCAGATTGTTGATGAXGAGGCACCAGAAACATGTGGGGTA
CTTTCCAATTTCAATGGACCTGGAGTGAAAGATGAGCAGCAGAGGGTTTACAAAAACAAACAAATGGACAATGGATTTTGCAGAACAAAA
CCCTCATCAAACTGCTTTCTTTCATCAATAACTCATTTCAAAAATGCCCCCATTCCACCTTAA\
Edits in Original Sequence 
(5')XTGCAGGAAGAAGCTGGTAAAGCAGCATCAAAGAATAATGCAtAGACAATGTCTGTCTCCTCTCAGTGNTCAGTATCCCCGTTTCA
CTGGATCAAACTTCCTTGATCTCAACAAGCTCTTTNCCTATGTTATCCATCCATTGAACTCTCTTCTTGTCAATAATCTCNTTAGGTCCA
ACAACAGGACTTTTCNTAATACAACTTTTAAGaCCATTTCCAGCATCTAGACtGACCTCAGATTGTTGATGAXGAGGCACCAGAAACATG
TGGGGTACTTTCCAATTTCAATGGACCTGGAGTGtAAAGATGAGCAGCAGAGGGTTTACAAAAACAAACAAATGGACAATGGATTTTGCA
GAACAAAACCCTCATCAAACTGCTTTCTTTCATCAATAACTCATTTCAAAAATGCCCCCATTCCACCTTAA\(3')AACTGAAAAAGATC
CAATCTTTAACCTCATAAAGCCCCAAAATTTTCATATAGTTATCAAACACAAGCAATCAATTACACTAGATAACAAAGTTCTCCATTGAG
CTGACATTTAGTACACATAAAATAATGATGTCCCAAATCCAGCAGAAAACAACAAAAGTACTAATAAATTCTTGAGTAAAGAAGAAAAAA
AGGTAAACAAACACTATATATATTTATATATATTCAAGAAAGAAGCAAAACCCCATAATCAAGAAACAATAGTTTTGGGATTTGGAGGGG
TTTTCTTGATTGTGAATTCCAAAACAACCCCTCAATCAAACATCAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan