ESTScan Details for Unigene SGN-U255363

Score 
305
Direction 
Forward
Predicted Peptide Sequence 
MVEVFGGWLFVYQFYRVPQFNHNMQENQLYRKVCTYLNSLPCVEDSDFTNLISGDKSNEISLVLDSNQIVVDKFLSARVFWINEKDEFTG
LKSLVMKIRKKDKRRILQPYLQYIHSVFDEIEQRKKEVRLFVNVDNEPQRNGRWRSVPFTHPATFDTVVMDTDLKNXVKSDLESFQNQNS
TITDSAK
Predicted Coding Sequence 
ATGGTGGAGGTTTTTGGAGGATGGTTGTTTGTCTATCAGTTCTACAGGGTACCGCAATTCAATCACAACATGCAGGAAAATCAATTGTAT
CGAAAAGTTTGTACTTATCTGAATTCGCTCCCCTGTGTTGAAGATTCTGATTTCACCAACCTAATCTCCGGCGATAAGTCCAATGAAATT
AGCCTCGTTTTGGATTCAAATCAGATTGTTGTTGACAAATTCCTCAGCGCTAGAGTTTTCTGGATCAATGAAAAGGATGAATTTACTGGT
TTGAAATCGCTTGTTATGAAGATTAGGAAAAAGGATAAGCGTCGAATTCTACAGCCTTACCTTCAGTATATACACTCTGTGTTCGATGAA
ATTGAGCAGAGGAAAAAGGAGGTGAGATTATTCGTCAATGTAGATAATGAACCTCAGAGAAACGGACGGTGGAGATCAGTGCCGTTCACA
CATCCAGCAACTTTTGATACGGTAGTGATGGACACGGATCTCAAAAACANGGTGAAATCCGATTTGGAATCGTTTCAAAATCAAAACAGT
ACTATCACCGACTCGGCAAAG\
Edits in Original Sequence 
CATTTTCCCCTCAAATTCTCTTTTCCATCATCATACTTCATTACACTGTTTGATTTTTACTTTTTTTTTTTCAATCATGTTTTGGTATTT
GATTGCAATAATTGCTTCAGGTTTGTTTCTGAAGATTCTGTTGAAAACTTCTTTACTGCAAATTGTGAAAAA
(5')ATGGTGGAGGTTTT
TGGAGGATGGTTGTTaTGTCTATCAGTTCTACAGGGTACCGCAATTCAATCACAACATGCAGGAAAATCAATTGTATCGAAAAGTTTGTA
CTTATCTGAATTCGCTCCCCTGTGTTGAAGATTCTGATTTCACCAACCTAATCTCCGGCGATAAGTCCAATGAAATTAGCCTCGTTTTGG
ATTCAAATCAGATTGTTGTTGACAAATTCCTCAGCGCTAGAGTTTTCTGGATCAATGAAAAGGATGAATTTACTGGTTTGAAATCGCTTG
TTATGAAGATTAGGAAAAAGGATAAGCGTCGAATTCTACAGCCTTACCTTCAGTATATACACTCTGTGTTCGATGAAATTGAGCAGAGGA
AAAAGGAGGTGAGATTATTCGTCAATGTAGATAATGAACCTCAGAGAAACGGACGGTGGAGATCAGTGCCGTTCACACATCCAGCAACTT
TTGATACGGTAGTGATGGACACGGATCTCAAAAACANGGTGAAATCCGATTTGGAATCGTTTCAAAATCAAAACAGTACTATCACCGACT
CGGCAAAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan