ESTScan Details for Unigene SGN-U255478

Score 
1566
Direction 
Forward
Predicted Peptide Sequence 
MALSSTSTTNSLLPNRSLVQNQPLLPSPLKNAFFSNNSTKTVRFVQPISAVHSSDSNKNPIVSDKPSKSSPPAATATTAPAVTKTEWAVD
SWKTKKALQLPEYPNQEELRSVLKTIDEFPPIVFAGEARSLEERLGEAAMGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFG
GQMPVIKVGRMAGQFAKPRSDSFEEKDGVKLPSYRGDNVNGDAFDVKSRTPDPQRLIRAYCQSAATLNLLRAFATGGYAAMQRINQWNLD
FTEHSEQGDRYRELASRVDEALGFMTAAGLTMDHPIMKTTEFWTSHECLLLPYEQSLTRRDSTSGLYYDCSAHFLWVGERTRQLDGAHVE
FLRGIANPLGIKVSDKMDPSALVKLIEILNPQNKAGRITIITRMGAENMRVKLPHLIRAVRRAGQIVTWVSDPMHGNTIKAPCGLKTRPF
DSIRAEVRAFFDVHDQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLSSRYHTHCDPRLNASQSLELSFIIAERXEEKEARIAKRFRAI
DIW
Predicted Coding Sequence 
ATGGCTCTTTCAAGTACTAGCACTACCAACTCTCTTCTCCCCAACAGATCTTTGGTTCAAAATCAACCCCTTCTGCCTTCTCCTTTAAAG
AATGCATTTTTCTCCAACAACTCAACCAAAACCGTTAGATTTGTTCAACCTATCTCAGCTGTTCATTCATCTGATTCTAACAAAAACCCC
ATTGTTTCCGATAAGCCCTCCAAGTCTTCTCCACCGGCGGCCACTGCCACCACGGCTCCGGCTGTGACCAAAACTGAATGGGCGGTGGAT
AGCTGGAAAACTAAGAAGGCACTTCAGCTACCGGAATACCCAAATCAAGAGGAGCTTAGATCTGTTCTTAAGACGATCGATGAGTTCCCT
CCTATCGTGTTTGCTGGTGAGGCTAGGAGCCTTGAAGAACGCCTTGGTGAAGCTGCTATGGGAAGGGCGTTTTTGTTACAAGGAGGAGAT
TGTGCTGAGAGTTTCAAGGAATTCAATGCTAATAATATTAGGGATACTTTCAGAATCCTCCTTCAAATGGGTGCTGTTCTTATGTTTGGC
GGTCAGATGCCTGTGATCAAGGTTGGAAGAATGGCTGGGCAATTTGCAAAGCCAAGATCAGATTCATTTGAGGAGAAGGATGGTGTAAAG
CTGCCGAGTTACAGGGGAGACAATGTCAACGGTGATGCATTTGATGTCAAGTCCAGGACTCCTGACCCCCAGAGGCTGATCAGGGCCTAT
TGCCAATCTGCAGCTACTTTGAATCTGTTGAGGGCTTTCGCTACTGGAGGATATGCTGCCATGCAGAGGATCAATCAGTGGAACTTGGAT
TTCACAGAGCATAGTGAGCAGGGTGATAGGTACCGTGAACTAGCTAGTAGAGTGGATGAGGCCCTTGGTTTCATGACTGCAGCTGGACTT
ACAATGGACCATCCTATTATGAAAACCACTGAGTTCTGGACATCTCATGAGTGCTTACTTTTGCCCTATGAGCAGTCACTAACACGTCGG
GATTCAACTTCTGGCCTTTACTATGATTGCTCTGCTCATTTCCTTTGGGTTGGAGAGAGAACCAGGCAGTTGGATGGTGCCCATGTTGAG
TTCTTGAGAGGAATTGCCAACCCCCTCGGTATTAAGGTGAGTGACAAGATGGACCCAAGTGCATTGGTCAAGCTCATTGAGATTTTGAAC
CCACAAAACAAAGCTGGAAGGATTACAATAATTACCAGAATGGGAGCAGAAAACATGAGGGTTAAACTTCCTCATCTTATCAGGGCAGTC
CGAAGAGCAGGACAAATTGTGACTTGGGTATCTGATCCTATGCACGGAAATACCATCAAGGCTCCTTGTGGTCTAAAAACTCGACCTTTT
GATTCCATCAGGGCCGAGGTAAGAGCATTCTTTGATGTTCATGATCAAGAAGGAAGCCACCCAGGAGGAGTTCATCTGGAGATGACAGGC
CAAAACGTCACAGAGTGCATCGGTGGATCACGAACTGTGACCTTTGATGATCTGAGCTCACGTTACCACACCCACTGTGATCCTAGGCTC
AATGCATCTCAATCCCTTGAGCTCTCATTCATTATCGCAGAACGTXTTGAGGAAAAGGAGGCTCGGATCGCAAAGCGTTTTAGGGCAATA
GATATTTGG\
Edits in Original Sequence 
CATCCATCCATCTCTCTCTCCATAACAAAAGAGGTGCCCAAATAGAGAAAATTACACTTCATAAACTCTCACATTTGTCTTTTCACAAAA
TAGCA
(5')ATGGCTCTTTCAAGTACTAGCACTACCAACTCTCTTCTCCCCAACAGATCTTTGGTTCAAAATCAACCCCTTCTGCCTTCT
CCTTTAAAGAATGCATTTTTCTCCAACAACTCAACCAAAACCGTTAGATTTGTTCAACCTATCTCAGCTGTTCATTCATCTGATTCTAAC
AAAAACCCCATTGTTTCCGATAAGCCCTCCAAGTCTTCTCCACCGGCGGCCACTGCCACCACGGCTCCGGCTGTGACCAAAACTGAATGG
GCGGTGGATAGCTGGAAAACTAAGAAGGCACTTCAGCTACCGGAATACCCAAATCAAGAGGAGCTTAGATCTGTTCTTAAGACGATCGAT
GAGTTCCCTCCTATCGTGTTTGCTGGTGAGGCTAGGAGCCTTGAAGAACGCCTTGGTGAAGCTGCTATGGGAAGGGCGTTTTTGTTACAA
GGAGGAGATTGTGCTGAGAGTTTCAAGGAATTCAATGCTAATAATATTAGGGATACTTTCAGAATCCTCCTTCAAATGGGTGCTGTTCTT
ATGTTTGGCGGTCAGATGCCTGTGATCAAGGTTGGAAGAATGGCTGGGCAATTTGCAAAGCCAAGATCAGATTCATTTGAGGAGAAGGAT
GGTGTAAAGCTGCCGAGTTACAGGGGAGACAATGTCAACGGTGATGCATTTGATGTCAAGTCCAGGACTCCTGACCCCCAGAGGCTGATC
AGGGCCTATTGCCAATCTGCAGCTACTTTGAATCTGTTGAGGGCTTTCGCTACTGGAGGATATGCTGCCATGCAGAGGATCAATCAGTGG
AACTTGGATTTCACAGAGCATAGTGAGCAGGGTGATAGGTACCGTGAACTAGCTAGTAGAGTGGATGAGGCCCTTGGTTTCATGACTGCA
GCTGGACTTACAATGGACCATCCTATTATGAAAACCACTGAGTTCTGGACATCTCATGAGTGCTTACTTTTGCCCTATGAGCAGTCACTA
ACACGTCGGGATTCAACTTCTGGCCTTTACTATGATTGCTCTGCTCATTTCCTTTGGGTTGGAGAGAGAACCAGGCAGTTGGATGGTGCC
CATGTTGAGTTCTTGAGAGGAATTGCCAACCCCCTCGGTATTAAGGTGAGTGACAAGATGGACCCAAGTGCATTGGTCAAGCTCATTGAG
ATTTTGAACCCACAAAACAAAGCTGGAAGGATTACAATAATTACCAGAATGGGAGCAGAAAACATGAGGGTTAAACTTCCTCATCTTATC
AGGGCAGTCCGAAGAGCAGGACAAATTGTGACTTGGGTATCTGATCCTATGCACGGAAATACCATCAAGGCTCCTTGTGGTCTAAAAACT
CGACCTTTTGATTCCATCAGGGCCGAGGTAAGAGCATTCTTTGATGTTCATGATCAAGAAGGAAGCCACCCAGGAGGAGTTCATCTGGAG
ATGACAGGCCAAAACGTCACAGAGTGCATCGGTGGATCACGAACTGTGACCTTTGATGATCTGAGCTCACGTTACCACACCCACTGTGAT
CCTAGGCTCAATGCATCTCAATCCCTTGAGCTCTCATTCATTATCGCAGAACGTXTTGAGGAAAAGGAGGCTCGGATCGCAAAGCGTTTT
AGGGCAATAGATATTTGG\(3')AAATGTTCAAGTACTGCCTTTTTCTATTTACTTCTTCACTTATATTATGAATGTTTGTATTAAAAAT
TGTATTTTCTTAAATCCTATTTGGAGGATGTATGTTATGTTTGCGCTACGTGCATACTGAAATTGTTTTAATGTAATGAGAGTTTGGTGA
GACTAAGCAATAAAGCAAGGAAGTTACTCTTAAAAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan