ESTScan Details for Unigene SGN-U256065

Score 
398
Direction 
Forward
Predicted Peptide Sequence 
SVVVFLHGFLGTGGDWISVMKAISGSARCIAVDLPGHGRSKLLGQDFDLEEPGLSIMAFAKILQQLFDSLQCQKVVLVGYSMGARISLYM
ALRYNYKVAGAVIISGSPGLIDEEARKVRRAKDDFFACSFAASGLEPFLDAGILESSGIV
Predicted Coding Sequence 
XXTAGTGTAGTAGTATTTCTTCATGGCTTCCTTGGAACTGGAGGAGATTGGATCTCTGTTATGAAGGCTATATCAGGCTCAGCTAGATGC
ATTGCAGTGGACCTACCTGGACATGGAAGATCAAAGTTGCTCGGCCAGGATTTTGATTTGGAGGAACCAGGGTTGTCAATTATGGCCTTT
GCAAAAATATTGCAGCAGTTGTTTGACAGCCTACAGTGTCAAAAAGTTGTTCTTGTTGGATATTCTATGGGAGCAAGGATTTCACTCTAC
ATGGCTCTAAGATACAATTACAAGGTTGCTGGAGCTGTTATAATATCTGGAAGTCCTGGATTGATAGATGAAGAGGCAAGAAAAGTGCGT
AGAGCCAAGGATGATTTTTTCGCCTGCTCTTTTGCTGCTTCTGGCTTAGAGCCATTTTTAGATGCTGGTATTCTGGAGAGCTCTGGAATA
GTTTAA\
Edits in Original Sequence 
(5')XXTAGTGTAGTAGTATTTCTTCATGGCTTCCTTGGAACTGGAGGAGATTGGATCTCTGTTATGAAGGCTATATCAGGCTCAGCTAG
ATGCATTGCAGTGGACCTACCTGGACATGGAAGATCAAAGTTGCTCGGCCAGGATTTTGATTTGGAGGAACCAGGGTTGTCAATTATGGC
CTTTGCAAAAATATTGCAGCAGTTGTTTGACAGCCTACAGTGTCAAAAAGTTGTTCTTGTTGGATATTCTATGGGAGCAAGGATTTCACT
CTACATGGCTCTAAGATACAATTACAAGGTTGCTGGAGCTGTTATAATATCTGGAAGTCCTGGATTGATAGATGAAGAGGCAAGAAAAGT
GCGTAGAGCCAAGGATGATTTTTTCGCCTGCTCTTTTGCTGCTTCTGGCTTAGAGCCATTTTTAGATGCtTGGTATTCTGGAGAGCTCTG
GAATAGTTTAA\(3')GAACTCATCCACATTTCAATAAAATACTTGCGAGCCGATTGCAGCATTGTGATCTGAAAAATCTTGAGAGAGTA
TTAGCAGATCTGAGTGTTGGGAGACAGCCGAAAGAGGCTAAAAAGGAAAACAGAAAGTTCAAGTAGGAAAAGCTATTAAACTAAATAGAA
AGGAAAAAATGACATTTTTTAGGAAGAAAATTTCATTCACAAGAGTCTTTCTTGCCGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan