ESTScan Details for Unigene SGN-U256484

Score 
576
Direction 
Forward
Predicted Peptide Sequence 
MGIKGLMKLLADNAPSGMKEQKFESYFGRKIAIDASMSIYQFLIVVGRSGTEMLTNEAGETTSXFGWDVFAAIRLLEAGIKPVYVFDGKP
PDLKKQELAKRYSRREDATDDLAKATESGNKEDIEKFSKRTVKVTPQHNDDCKKLLRLMGVPAVEAPSEAEAQCAALCKAEKVYAVASED
MDSLTFGAPKFLRHLMDPSXQKIPVMEFX
Predicted Coding Sequence 
ATGGGAATTAAGGGTTTAATGAAGCTGTTGGCTGATAATGCTCCAAGTGGAATGAAGGAGCAGAAATTCGAGAGTTATTTCGGTCGTAAA
ATAGCAATCGATGCTAGTATGAGCATTTACCAGTTCCTGATTGTAGTAGGACGAAGCGGTACGGAAATGCTCACTAACGAAGCTGGGGAA
ACTACTAGTXCATTTGGTTGGGATGTTTTCGCGGCGATTAGGCTTCTGGAAGCTGGAATCAAGCCTGTTTATGTTTTTGATGGTAAGCCC
CCTGATTTGAAGAAGCAAGAACTTGCAAAACGTTACTCTAGAAGGGAAGATGCCACAGATGACTTGGCTAAGGCTACAGAGAGTGGCAAC
AAGGAGGATATTGAGAAATTCAGCAAGAGAACAGTAAAGGTTACGCCACAACACAATGATGACTGCAAAAAGCTTCTCAGACTAATGGGG
GTACCTGCTGTTGAGGCTCCTTCTGAAGCAGAGGCCCAGTGTGCTGCACTTTGCAAGGCAGAAAAGGTTTATGCTGTGGCCTCTGAAGAT
ATGGATTCCTTAACTTTTGGAGCTCCAAAGTTTCTTCGCCATTTAATGGATCCTAGCTXCCAAAAGATACCAGTGATGGAATTTGAX\
Edits in Original Sequence 
AAATTGGCTAAGCTTTCTGAGTTCGTTCAATCCAAAAT(5')ATGGGAATTAAGGGTTTAATGAAGCTGTTGGCTGATAATGCTCCAAGT
GGAATGAAGGAGCAGAAATTCGAGAGTTATTTCGGTCGTAAAATAGCAATCGATGCTAGTATGAGCATTTACCAGTTCCTGATTGTAGTA
GGACGAAGCGGTACGGAAATGCTCACTAACGAAGCTGGGGAAACTACTAGTXCATTTGGTTGGGATGTTTTCGCGGaCGATTAGGCTTCT
GGAAGCTGGAATCAAGCCTGTTTATGTTTTTGATGGTAAGCCCCCTGATTTGAAGAAGCAAGAACTTGCAAAACGTTACTCTAGAAGGGA
AGATGCCACAGATGACTTGGCTAAGGCTACAGAGAGTGGCAACAAGGAGGATATTGAGAAATTCAGCAAGAGAACAGTAAAGGTTACGCC
ACAACACAATGATGACTGCAAAAAGCTTCTCAGACTAATGGGGGTACCTGCTGTTGAGGCTCCTTCTGAAGCAGAGGCCCAGTGTGCTGC
ACTTTGCAAGGCAGAAAAGGTTTATGCTGTGGCCTCTGAAGATATGGATTCCTTAACTTTTGGAGCTCCAAAGTTTCTTCGCCATTTAAT
GGATCCTAGCTXCCAAAAGATACCAGTGATGGAATTTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan