ESTScan Details for Unigene SGN-U256491

Score 
296
Direction 
Forward
Predicted Peptide Sequence 
LKAQEEWVAANRLNAQAAKNILTTRNGKNDQWTLDLHGLHAKEAVQALQEHLQKIESQVAQNLVAHMNQVNLKRSLGAAVSIDVENESKG
SLLNKQRPAFLEVITGKGIHSRGQATLPMAIRSFLVENGYRYEETRPGAITVRPKFRPR
Predicted Coding Sequence 
XXTCTAAAAGCCCAAGAAGAGTGGGTTGCTGCTAATAGGCTAAATGCCCAGGCCGCAAAAAATATTTTGACTACCCGCAACGGTAAGAAT
GATCAATGGACACTGGACTTGCATGGTCTTCATGCAAAAGAGGCAGTTCAAGCCTTACAAGAACATTTGCAAAAGATTGAATCTCAGGTG
GCACAGAATCTTGTTGCCCATATGAATCAAGTGAACTTGAAGCGCAGCTTAGGAGCTGCTGTCTCTATTGATGTGGAGAATGAGAGCAAA
GGGTCCCTATTGAATAAGCAGCGGCCAGCTTTCTTAGAGGTCATAACAGGTAAAGGTATTCATAGCCGGGGACAAGCTACGCTTCCAATG
GCTATAAGAAGCTTTCTTGTGGAGAACGGATATCGTTATGAGGAGACAAGGCCTGGGGCGATCACAGTTAGACCCAAGTTCCGACCACGA
TAA\
Edits in Original Sequence 
(5')XXTCTAAAAGCCCAAGAAGAGTGGGTTGCTGCTAATAGGCTAAATGCCCAGGCCGCAAAAAATATTTTGACTACCCGCAACGGTAA
GAATGATCAATGGACACTGGACTTGCATGGTCTTCATGCAAAAGAGGCAGTTCAAGCCTTACAAGAACATTTGCAAAAGATTGAATCTCA
GGTGGCACAGAATCTTGTTGCCCATATGAATCAAGTGAACTTGAAGCGCAGCTTAGGAGCTGCTGTCTCTATTGATGTGGAGAATGAGAG
CAAAGGGTCCCTATTGAATAAGCAGCGGCCAGCTTTCTTAGAGGTCATAACAGGTAAAGGTATTCATAGCCGGGGACAAGCTACGCTTCC
AATGGCTATAAGAAGCTTTCTTGTGGAGAACGGATATCGTTATGAGGAGACAAGGCCTGGGGCGATCACAGTTAGACCCAAGTTCCGACC
ACGATAA\(3')ATATGTTCGTATGTATATTTTGGGTCCCAGACTTAGTGCATTTGTTTCTGTTGCTATCAACTTTGTCCGAGAGATTTT
GAGTCTTGAACTGGTCTGATAAAAACGACCAGAAACCTGTTGTGGTTTTATGTATAACTGTATACTGTTGAATATTTCTGTAATTGTATA
CCGTCAAACATTATATGTACTTGCTGATTTCTCCACAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan