ESTScan Details for Unigene SGN-U256610

Score 
332
Direction 
Forward
Predicted Peptide Sequence 
FFLRRKDFTLTTRRSPSLSIHRALAXLVASXTLSMGASESVLSGSQGPIDEITTVSERVEGVDPILERLKSLKIAAPILKSPPAESSLTD
ILVRKAPPLQIKAAVDPKVLLELFSVYRQWQEEKAQKICKRQEEIENKIEVADALAVKLLQRFNYSVSAMKTTSQHLSEX
Predicted Coding Sequence 
XXGTTCTTCCTCCGGCGAAAAGATTTTACTCTTACTACTAGGAGAAGTCCATCCCTGTCTATTCATCGGGCTTTAGCACXGCTAGTCGCT
TCTGXTACCCTTTCAATGGGTGCATCCGAATCAGTTCTCTCCGGCTCACAAGGGCCAATCGATGAGATCACCACAGTTTCTGAGCGTGTA
GAAGGCGTTGATCCTATTTTGGAGAGGCTAAAATCTCTCAAAATTGCTGCTCCAATACTGAAATCGCCGCCAGCTGAGAGTAGCTTGACT
GACATTCTGGTGAGGAAAGCTCCTCCACTTCAAATAAAGGCTGCXGTAGATCCAAAAGTTCTACTTGAGCTCTTCTCTGTATATCGCCAG
TGGCAAGAGGAGAAGGCCCAGAAGATCTGTAAAAGACAGGAAGAAATAGAAAACAAAATAGAAGTTGCAGATGCATTGGCTGTTAAGCTT
CTTCAACGCTTCAATTACTCTGTTTCCGCAATGAAAACAACCTCACAGCATCTATCAGAAGXX\
Edits in Original Sequence 
(5')XXGTTCTTCCTCCGGCGAAAAGATTTTACTCTTACTACTAGGAGAAGTCCATCCCTGTCTATTCATCGGGCTTTAGCACXGCTAGT
CGCTTCTGXTACCCTTTCAATGGGTGCATCCGAATCAGTTCTCTCCGGCTCACAAGGGCCAATCGATGAGATCACCACAGTTTCTGAGCG
TGTAGAAGGCGTTGATCCTATTTTGGAGAGGCTAAAATCTCTCAAAATTGCTGCTCCAATACTGAAATCGCCGCCAGCTGAGAGTAGCTT
GACTGACATTCTGGTGAGGAAAGCaTCCTCCACTTCAAATAAAGGCTGCXGTAGATCCAAAAGTTCTACTTGAGCTCTTCTCTGTATATC
GCCAGTGGCAAGAGGAGAAGGCCCAGAAGATCTGTAAAAGACAGGAAGAAATAGAAAACAAAATAGAAGTTGCAGATGCATTGGCTGTTA
AGCTTCTTCAACGCTTCAATTACTCTGTTTCCGCAATGAAAACAACCTCACAGCATCTATCAGAAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan