ESTScan Details for Unigene SGN-U257426

Score 
147
Direction 
Reverse
Predicted Peptide Sequence 
MNCRNPQEPTPDEFVHRETVNSFPTSGVFKVSKDFATKMSFSMILLQPYRRAPVLELKPLLYALHMIPVFASQVPYFISDHVLLLTNAAL
DVISXPHQLLVFLFLKPYPX
Predicted Coding Sequence 
ATGAATTGCAGGAATCCACAAGAACCAACCCCAGATGAATTTGTACACAGGGAAACTGTTAACAGCTTTCCCACATCTGGAGTTTTTAAG
GTATCTAAAGATTTTGCAACTAAGATGTCATTTTCGATGATTCTACTGCAGCCTTACAGAAGGGCACCAGTTCTTGAGCTTAAACCACTG
CTTTATGCACTCCATATGATACCCGTGTTCGCATCCCAGGTTCCCTATTTCATCTCCGATCACGTACTCCTCCTGACAAATGCTGCACTT
GATGTCATCTCCGXTCCTCATCAGCTTCTAGTGTTTCTGTTTCTGAAGCCATACCCTGXX\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTTAGAGCAAGCAAATGATTGAAACACTTTAGCAAAGGTTGAAGGAAATGAATATGAAGACATTC
ACCACCACAAAGCCAGAAAAAGGCCTGGGTTTATTGGTTCATATGGCAAGAGCAATTAAGTAAAAGAAAAAGAGAAAAAAAAAGTTCAAG
AAAATAGAGAAAAAAACTAAAAAGAGAACAGTAAAT
(5')ATGAATTGCAGGAATCCACAAGAACCAAcCCCCAGATGAATTTGTACACA
GGGAAACTGTTAACAGCTTTCCCACATCTGGAGTTTTTAAGGTATCTAAAGATTTTGCAACTAAGATGTCATTTTCGATGATTCTACTGC
AGCCTTACAGAtAGGGCACCAGTTCTTGAGCTTAAACCACTGCTTTATGCACTCCATATGATACCCGTGTTCGCATCCCAGGTTCCCTAT
TTCATCTCCGATCACGTACTCCTCCTGACAAATGCTGCACTTGATGTCATCTCCGXTCCTCATCAGCTTCTAGTGTTTCTGTTTCTGAAG
CCATACCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan