ESTScan Details for Unigene SGN-U257743

Score 
466
Direction 
Forward
Predicted Peptide Sequence 
MTNYYEFVKSTSCEDSLKAIEADIQYANLLAASIPRFKNGTCLQMKLVYSNLAPXTSVLAPVDGLLMHMLTSKFFNFFHITVYKVIPNGK
KKIPSDARKASIREFYAVLLPSLRHLHDSSSEQASSHDEPQVSKMIVGKKVQDKKHFDADLEKENECGICLEPCTKVVLPNCCHAMCISC
YRDWNLRSESCPFCRGNLKRVNSGDLWVLTGSNDVX
Predicted Coding Sequence 
ATGACGAATTACTATGAGTTTGTGAAATCTACTTCATGTGAAGATTCTTTAAAGGCAATTGAGGCTGACATTCAGTATGCCAATTTGCTG
GCAGCTTCAATTCCGAGGTTCAAGAATGGTACTTGTCTACAAATGAAATTGGTGTACAGTAACTTGGCACCGGXTACTTCTGTTCTTGCT
CCAGTGGATGGATTGCTCATGCACATGCTTACTTCCAAGTTTTTCAATTTTTTCCACATAACTGTATACAAGGTTATCCCCAATGGGAAG
AAGAAGATTCCTTCTGATGCTAGGAAAGCAAGCATTAGAGAATTCTATGCTGTTCTATTACCATCTCTACGGCACCTACATGATAGCTCA
TCAGAGCAGGCGAGTAGTCATGACGAACCTCAAGTTTCAAAAATGATTGTTGGGAAGAAAGTACAAGATAAAAAACATTTTGATGCTGAT
CTAGAGAAAGAAAATGAATGCGGGATCTGCTTAGAACCATGCACTAAAGTAGTTTTGCCAAACTGCTGTCATGCTATGTGCATTAGTTGC
TATCGTGACTGGAACTTAAGGTCAGAGTCCTGCCCATTTTGCAGAGGAAACCTCAAAAGAGTGAATTCAGGGGATCTGTGGGTTCTGACA
GGCAGTAACGATGTCGXX\
Edits in Original Sequence 
CTTCTTCTTCTTTGTAAGTGTTCAACATTTTACTCCTATATTACATATACCCAAATTGAGTGTTTAGCAAGAAAAAGTGTGGTACATTTG
GGAATTGCAGTTTTGGGATTATTG
(5')ATGACGAATTACTATGAGTTTGTGAAATCTACTTCATGTGAAGATTCTTTAAAGGCAATTGA
GGCTGACATTCAGTATGCCAATTTGCTGGCAGCTTCAATTCCGAGGTTCAAGAATGGTACTTGTCTACAAATGAAATTGGTGTACAGTAA
CTTGGCACCGGXTACTTCTGTTCTTGCTCCAGTGGATGGATTGCTCATGCACATGCTTACTTCCAAGTTaTTTCAATTTTTTCCACATAA
CTGTATACAAGGTTATCCCCAATGGGAAGAAGAAGATTCCTTCTGATGCTAGGAAAGCAAGCATTAGAGAATTCTATGCTGTTCTATTAC
CATCTCTACGGCACCTACATGATAGCTCATCAGAGCAGGCGAGTAGTCATGACGAACCTCAAGTTTCAAAAATGATTGTTGGGAAGAAAG
TACAAGATAAAAAACATTTTGATGCTGATCTAGAGAAAGAAAATGAATGCGGGATCTGCTTAGAACCATGCACTAAAGTAGTTTTGCCAA
ACTGCTGTCATGCTATGTGCATTAGTTGCTATCGTGACTGGAACTTAAGGTCAGAGTCCTGCCCATTTTGCAGAGGAAACCTCAAAAGAG
TGAATTCAGGGGATCTGTGGGTTCTGACAGGCAGTAACGATGTCGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan